General Information of the Molecule (ID: Mol00733)
Name
Efflux pump membrane transporter MdsB (MDSB) ,Salmonella enterica serovar Typhimurium
Synonyms
sat4; Streptothricin acetyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
MdsB
Sequence
MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTVQVSASYPGANPQVIA
DTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDMAQIQVQNRVSRALPRL
PEEVQRIGVVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFAIRQVRDELARLPGVGDVLVW
GAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSVGQQPEASAAFQMTVNTLG
RLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRSLLNGEAAPALQIIQSPGAN
AIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVFVRASLQSVAITLLEALVLVVLVVVMF
LQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFGLVLSIGIVVDDAIVVVENVER
HISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSAFLAGLQGEFYRQFALTIAISTI
LSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGTVTGGFFHRFNRFFDSASNRYVSAV
RRAVRGSVIVMVLYAGFVGLTWLGFHQVPNGFVPAQDKYYLVGIAQLPSGASLDRTEAVV
KQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSALMFAMLKPFDEREDPSLSANAIAGKL
MHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIEDRAELGFEAMTKVQSEIMSKAMQTPE
LANMLASFQTNAPQLQVDIDRVKAKSMGVSLTDIFETLQINLGSLYVNDFNRFGRAWRVM
AQADAPFRMQQEDIGLLKVRNAKGEMIPLSAFVTIMRQSGPDRIIHYNGFPSVDISGGPA
PGFSSGQATDAIEKIVRETLPEGMVFEWTDLVYQEKQAGNSALAIFALAVLLAFLILAAQ
YNSWSLPFAVLLIAPMSLLSAIVGVWVSGGDNNIFTQIGFVVLVGLAAKNAILIVEFARA
KEHDGADPLTAVLEASRLRLRPILMTSFAFIAGVVPLVLATGAGAEMRHAMGIAVFAGML
GVTLFGLLLTPVFYVVVRRMALKRENRVDSHDQQA
    Click to Show/Hide
Uniprot ID
A0A0D6HCN1_SALTM
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica subsp. enterica serovar Typhimurium
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Acriflavine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Acriflavine
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Gentian violet
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Gentian violet
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Methylene blue
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Methylene blue
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Novobiocin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Novobiocin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Rhodamine 6G
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Rhodamine 6G
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Investigative Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Benzalkonium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Benzalkonium bromide
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Homidium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Homidium bromide
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Sodium deoxycholate
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Sodium deoxycholate
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
Tetraphenylphosphonium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Tetraphenylphosphonium bromide
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of MdsABC confers drug resistance.
References
Ref 1 Virulence and drug resistance roles of multidrug efflux systems of Salmonella enterica serovar Typhimurium. Mol Microbiol. 2006 Jan;59(1):126-41. doi: 10.1111/j.1365-2958.2005.04940.x.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.