Molecule Information

General Information of the Molecule (ID: Mol01173)
Name
ABC protein lsaC (lsaC-Unclear) ,Streptococcus agalactiae
Molecule Type
Protein
Gene Name
lsaC
Sequence
MSTIKIENLTFSYYGYVKPVFENVSFSFDTNWKTGLIGRNGIGKSTLFKLLLNQEVYKGK
ISKSVDFIKFPPNLSDTSKLGIELYRELISDEEEWKLFRELHLLKVDESLIYRKFETLSK
GEQTKILLAILFTREDGFLLIDEPTNHLDMDGRKIVSEYLKNKKGFLLISHDRDFLDGCI
NHIISINRNSIDVQSGNFTSWYENKLMKDQFEISQNEKLRKDIKRLKEAARQSQIWSDKV
ENTKNGVKVSGVKPDKGHIGHQSAKMMKKSKNLENRQNKAIEEKQNLLKDIETKESLLLH
PLHHHKNPLISVCDLSSYYGKKQILSNISFDIKQGDIVAIYGGNGSGKSTLIKILLGLNH
EYSGDVKLASNLKISYVPQDTSNLTGSLNEYIHKQGVDETLCKTILRKLDFARELFEIDM
KNYSDGQKKKVLIAVSLSKSAHIFIWDEPLNYLDVISRIQIEEIIKEANPTLIFVEHDKS
FVEDIANKIIRL
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Streptococcaceae
Genus: Streptococcus
Species: Streptococcus agalactiae
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clindamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Klebsiella pneumoniae [1]
Resistant Disease Klebsiella pneumoniae [ICD-11: CA40.0]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae inection [1]
Resistant Disease Streptococcus agalactiae inection [ICD-11: FB84.0]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Dalfopristin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Klebsiella pneumoniae [1]
Resistant Disease Klebsiella pneumoniae [ICD-11: CA40.0]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae inection [1]
Resistant Disease Streptococcus agalactiae inection [ICD-11: FB84.0]
 Disease Info 
Resistant Drug Dalfopristin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Lincomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Klebsiella pneumoniae [1]
Resistant Disease Klebsiella pneumoniae [ICD-11: CA40.0]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae inection [1]
Resistant Disease Streptococcus agalactiae inection [ICD-11: FB84.0]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Tiamulin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Klebsiella pneumoniae [1]
Resistant Disease Klebsiella pneumoniae [ICD-11: CA40.0]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae infection [1]
Resistant Disease Streptococcus agalactiae infection [ICD-11: 1B21.2]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
Disease Class: Streptococcus agalactiae inection [1]
Resistant Disease Streptococcus agalactiae inection [ICD-11: FB84.0]
 Disease Info 
Resistant Drug Tiamulin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus ATCC 29213 1280
Streptococcus agalactiae UCN70 1311
Streptococcus agalactiae isolates 1311
Streptococcus agalactiae BM132 1319
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description Expression of this novel gene, named lsa(C), in S. agalactiae BM132 after cloning led to an increase in MICs of lincomycin (0.06 to 4 ug/ml), clindamycin (0.03 to 2 ug/ml), dalfopristin (2 to >32 ug/ml), and tiamulin (0.12 to 32 ug/ml), whereas no change in MICs of erythromycin (0.06 ug/ml), azithromycin (0.03 ug/ml), spiramycin (0.25 ug/ml), telithromycin (0.03 ug/ml), and quinupristin (8 ug/ml) was observed. The phenotype was renamed the LS(A)P phenotype on the basis of cross-resistance to lincosamides, streptogramins A, and pleuromutilins.
References
Ref 1 Cross-resistance to lincosamides, streptogramins A, and pleuromutilins due to the lsa(C) gene in Streptococcus agalactiae UCN70. Antimicrob Agents Chemother. 2011 Apr;55(4):1470-4. doi: 10.1128/AAC.01068-10. Epub 2011 Jan 18.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.