General Information of the Molecule (ID: Mol00999)
Name
MATE family efflux transporter (ABEM) ,Acinetobacter baumannii
Synonyms
abeM; norM_1; norM_2; A7M90_01030; ABCAM1_0400; ABR2091_0395; APD31_09880; AUO97_09395; AYR68_01385; B7L45_17470; B9X95_14630; BS065_17005; CBE85_05175; CBL15_16565; H0529_14335; IMO23_01850; NCTC13305_02036; SAMEA104305281_01114; SAMEA104305385_01096; Multidrug ABC transporter; Multidrug efflux MATE transporter AbeM; Multidrug resistance protein norM
    Click to Show/Hide
Molecule Type
Protein
Gene Name
abeM
Gene ID
66398626
Sequence
MSNVTSFRSELKQLFHLMLPILITQFAQAGFGLIDTIMAGHLSAADLAAIAVGVGLWIPV
MLLFSGIMIATTPLVAEAKGARNTEQIPVIVRQSLWVAVILGVLAMLILQLMPFFLHVFG
VPESLQPKASLFLHAIGLGMPAVTMYAALRGYSEALGHPRPVTVISLLALVVLIPLNMIF
MYGLGPIPALGSAGCGFATSILQWLMLITLAGYIYKASAYRNTSIFSRFDKINLTWVKRI
LQLGLPIGLAVFFEVSIFSTGALVLSPLGEVFIAAHQVAISVTSVLFMIPLSLAIALTIR
VGTYYGEKNWASMYQVQKIGLSTAVFFALLTMSFIALGREQIVSVYTQDINVVPVAMYLL
WFAMAYQLMDALQVSAAGCLRGMQDTQAPMWITLMAYWVIAFPIGLYLARYTDWGVAGVW
LGLIIGLSIACVLLLSRLYLNTKRLSQT
    Click to Show/Hide
Uniprot ID
A0A077GDY5_ACIBA
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
12 drug(s) in total
Click to Show/Hide the Full List of Drugs
Acriflavine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Acriflavine
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Chloramphenicol
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Chloramphenicol
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Ciprofloxacin XR
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Daunorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Daunorubicin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Doxorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Doxorubicin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Erythromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Erythromycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Gentamicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Gentamicin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Kanamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Kanamycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Norfloxacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Ofloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Ofloxacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Triclosan
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Triclosan
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Trimethoprim
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Trimethoprim
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Rhodamine 6G
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Rhodamine 6G
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Discontinued Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Bisbenzimide (Hoechst 33258)
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Bisbenzimide (Hoechst 33258)
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Investigative Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
4',6-Diamidino-2-phenylindole
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug 4',6-Diamidino-2-phenylindole
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Homidium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Homidium bromide
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
Tetraphenylphosphonium chloride
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Tetraphenylphosphonium chloride
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Drug Resistance
MIC assay
Mechanism Description AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance.
References
Ref 1 AbeM, an H+-coupled Acinetobacter baumannii multidrug efflux pump belonging to the MATE family of transporters. Antimicrob Agents Chemother. 2005 Oct;49(10):4362-4. doi: 10.1128/AAC.49.10.4362-4364.2005.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.