Molecule Information
General Information of the Molecule (ID: Mol00999)
| Name |
MATE family efflux transporter (ABEM)
,Acinetobacter baumannii
|
||||
|---|---|---|---|---|---|
| Synonyms |
abeM; norM_1; norM_2; A7M90_01030; ABCAM1_0400; ABR2091_0395; APD31_09880; AUO97_09395; AYR68_01385; B7L45_17470; B9X95_14630; BS065_17005; CBE85_05175; CBL15_16565; H0529_14335; IMO23_01850; NCTC13305_02036; SAMEA104305281_01114; SAMEA104305385_01096; Multidrug ABC transporter; Multidrug efflux MATE transporter AbeM; Multidrug resistance protein norM
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
abeM
|
||||
| Gene ID | |||||
| Sequence |
MSNVTSFRSELKQLFHLMLPILITQFAQAGFGLIDTIMAGHLSAADLAAIAVGVGLWIPV
MLLFSGIMIATTPLVAEAKGARNTEQIPVIVRQSLWVAVILGVLAMLILQLMPFFLHVFG VPESLQPKASLFLHAIGLGMPAVTMYAALRGYSEALGHPRPVTVISLLALVVLIPLNMIF MYGLGPIPALGSAGCGFATSILQWLMLITLAGYIYKASAYRNTSIFSRFDKINLTWVKRI LQLGLPIGLAVFFEVSIFSTGALVLSPLGEVFIAAHQVAISVTSVLFMIPLSLAIALTIR VGTYYGEKNWASMYQVQKIGLSTAVFFALLTMSFIALGREQIVSVYTQDINVVPVAMYLL WFAMAYQLMDALQVSAAGCLRGMQDTQAPMWITLMAYWVIAFPIGLYLARYTDWGVAGVW LGLIIGLSIACVLLLSRLYLNTKRLSQT Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
12 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Acriflavine | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Ciprofloxacin XR | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Daunorubicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Gentamicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Norfloxacin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Ofloxacin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Triclosan | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
Clinical Trial Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Rhodamine 6G | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
Discontinued Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Bisbenzimide (Hoechst 33258) | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
Investigative Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | 4',6-Diamidino-2-phenylindole | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Homidium bromide | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Tetraphenylphosphonium chloride | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | AbeM was found to be an H+-coupled multidrug efflux pump and a unique member of the MATE family which lead to drug resistance. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
