Molecule Information
General Information of the Molecule (ID: Mol00195)
Name |
Transcriptional coactivator YAP1 (YAP1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog; YAP65
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
YAP1
|
||||
Gene ID | |||||
Location |
chr11:102110447-102233424[+]
|
||||
Sequence |
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGG TQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS DILNDMESVLAATKLDKESFLTWL Click to Show/Hide
|
||||
Function |
Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role in controlling cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Suppresses ciliogenesis via acting as a transcriptional corepressor of the TEAD4 target genes AURKA and PLK1. In conjunction with WWTR1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
10 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Nasopharyngeal carcinoma | [1] | |||
Resistant Disease | Nasopharyngeal carcinoma [ICD-11: 2B6B.0] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell invasion | Activation | hsa05200 | |
Cell viability | Activation | hsa05200 | ||
Hippo signaling pathway | Activation | hsa04391 | ||
In Vitro Model | CAL27 cells | Oral | Homo sapiens (Human) | CVCL_1107 |
SCC25 cells | Oral | Homo sapiens (Human) | CVCL_1682 | |
SCC4 cells | Tongue | Homo sapiens (Human) | CVCL_1684 | |
FaDu cells | Pharynx | Homo sapiens (Human) | CVCL_1218 | |
HN12 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_5518 | |
HN13 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_5519 | |
HN30 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_5525 | |
HN4 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_IS30 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis; RIP assay; Luciferase reporter assay | |||
Experiment for Drug Resistance |
MTT assay; Transwell assay | |||
Mechanism Description | LncRNA THOR acts as a co-activator of YAP and promotes YAP transcriptional activity,facilitating NPC stemness and attenuate cisplatin sensitivity. | |||
Disease Class: Nasopharyngeal carcinoma | [1] | |||
Resistant Disease | Nasopharyngeal carcinoma [ICD-11: 2B6B.0] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell invasion | Activation | hsa05200 | |
Cell viability | Activation | hsa05200 | ||
Hippo signaling pathway | Activation | hsa04391 | ||
In Vitro Model | CAL27 cells | Oral | Homo sapiens (Human) | CVCL_1107 |
SCC25 cells | Oral | Homo sapiens (Human) | CVCL_1682 | |
SCC4 cells | Tongue | Homo sapiens (Human) | CVCL_1684 | |
FaDu cells | Pharynx | Homo sapiens (Human) | CVCL_1218 | |
HN12 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_5518 | |
HN13 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_5519 | |
HN30 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_5525 | |
HN4 cells | Nasopharyngeal | Homo sapiens (Human) | CVCL_IS30 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Transwell assay | |||
Mechanism Description | LncRNA THOR acts as a co-activator of YAP and promotes YAP transcriptional activity,facilitating NPC stemness and attenuate cisplatin sensitivity. | |||
Disease Class: Esophageal squamous cell carcinoma | [2] | |||
Resistant Disease | Esophageal squamous cell carcinoma [ICD-11: 2B70.3] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
In Vitro Model | KYSE70 cells | Esophagus | Homo sapiens (Human) | CVCL_1356 |
KYSE140 cells | Esophagus | Homo sapiens (Human) | CVCL_1347 | |
KYSE170 cells | Esophagus | Homo sapiens (Human) | CVCL_1358 | |
KYSE190 cells | Esophagus | Homo sapiens (Human) | CVCL_8301 | |
KYSE520 cells | Esophagus | Homo sapiens (Human) | CVCL_1355 | |
KYSE590 cells | Esophagus | Homo sapiens (Human) | CVCL_8508 | |
KYSE890 cells | Esophagus | Homo sapiens (Human) | CVCL_A103 | |
KYSE960 cells | Esophagus | Homo sapiens (Human) | CVCL_8512 | |
kYSE450 cells | Esophagus | Homo sapiens (Human) | CVCL_1353 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
WST-1 assay | |||
Mechanism Description | When miR-141, which was the most highly expressed miRNA in the cisplatin-resistant cell lines, was expressed ectopically in thecisplatin-sensitive cell lines, cell viability after cisplatin treatment was increased significantly. miR-141 directly targeted the 3 -untranslated region ofYAP1, which is known to have a crucial role in apoptosis inducedby DNA-damaging agents, and thus downregulated YAP1 expression. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Prostate cancer | [3] | |||
Resistant Disease | Prostate cancer [ICD-11: 2C82.0] | |||
Resistant Drug | Docetaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | DU-145 cells | Prostate | Homo sapiens (Human) | CVCL_0105 |
PC3 cells | Prostate | Homo sapiens (Human) | CVCL_0035 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Annexin V-PE Apoptosis assay | |||
Mechanism Description | miR375 induces docetaxel resistance in prostate cancer by targeting SEC23A and YAP1. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Hepatocellular carcinoma | [4] | |||
Sensitive Disease | Hepatocellular carcinoma [ICD-11: 2C12.2] | |||
Sensitive Drug | Doxorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell viability | Inhibition | hsa05200 | ||
Hippo signaling pathway | Regulation | hsa04392 | ||
In Vitro Model | Huh-7 cells | Liver | Homo sapiens (Human) | CVCL_0336 |
HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 | |
In Vivo Model | NU/NU nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | miR-590-5p suppresses hepatocellular carcinoma chemoresistance by downregulating YAP1 expression. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Colorectal cancer | [5] | |||
Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
Sensitive Drug | Fluorouracil | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Hippo signaling pathway | Activation | hsa04391 | |
In Vitro Model | SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 |
HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis; Luciferase assay; miRNA immunoprecipitation assay | |||
Experiment for Drug Resistance |
Caspase-9 or 3 activity assays; Flow cytometric analysis | |||
Mechanism Description | Down-regulation of miR874-3p promotes chemotherapeutic resistance in colorectal cancer via inactivation of the Hippo signaling pathway. miR874-3p directly inhibited the expression of transcriptional co-activators YAP and TAZ of the Hippo signaling pathway, resulting in the inactivation of the TEAD transcription. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Lung adenocarcinoma | [6] | |||
Resistant Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | |||
Resistant Drug | Gefitinib | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell viability | Activation | hsa05200 | ||
miR630/YAP1/ERK signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | PC9 cells | Lung | Homo sapiens (Human) | CVCL_B260 |
PC9GR cells | Lung | Homo sapiens (Human) | CVCL_V337 | |
CL97 cells | Lung | Homo sapiens (Human) | CVCL_N826 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
Mechanism Description | Low miR-630 and high YAP1 mRNA levels are associated with unfavorable response to TkI therapy in lung adenocarcinoma patients. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Non-small cell lung cancer | [7] | |||
Sensitive Disease | Non-small cell lung cancer [ICD-11: 2C25.Y] | |||
Sensitive Drug | Gefitinib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell viability | Inhibition | hsa05200 | ||
In Vitro Model | PC9 cells | Lung | Homo sapiens (Human) | CVCL_B260 |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
Mechanism Description | The elevated sensitivity of PC 9GR cells to gefitinib following transfection with the miR 506 3p mimic was counteracted by the overexpression of YAP1. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [8] | |||
Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
Sensitive Drug | Gemcitabine | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | p73-mediated apoptosis signaling pathway | Inhibition | hsa04210 | |
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 | |
MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
T47D cells | Breast | Homo sapiens (Human) | CVCL_0553 | |
ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
BT-549 | Breast | Homo sapiens (Human) | CVCL_1092 | |
MCF-10A | Breast | Homo sapiens (Human) | CVCL_0598 | |
MDA-MB-436 cells | Breast | Homo sapiens (Human) | CVCL_0623 | |
MDA-MB-453 cells | Breast | Homo sapiens (Human) | CVCL_0418 | |
MDA-MB-468 cells | Breast | Homo sapiens (Human) | CVCL_0419 | |
ZR-75-30 cells | Breast | Homo sapiens (Human) | CVCL_1661 | |
Experiment for Molecule Alteration |
Immunoblotting assay | |||
Experiment for Drug Resistance |
TUNEL assays | |||
Mechanism Description | microRNA-200a confers chemoresistance by antagonizing TP53INP1 and YAP1 in human breast cancer Inhibition of miR200a enhances gemcitabine chemosensitivity in resistance cancer cells. TP53INP1 and YAP1 are involved in the RNA damage-induced p73-mediated apoptosis. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Non-small cell lung cancer | [9] | |||
Sensitive Disease | Non-small cell lung cancer [ICD-11: 2C25.Y] | |||
Sensitive Drug | Paclitaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
Cell migration | Inhibition | hsa04670 | ||
Cell proliferation | Inhibition | hsa05200 | ||
In Vitro Model | H1975 cells | Lung | Homo sapiens (Human) | CVCL_1511 |
A549 cells | Lung | Homo sapiens (Human) | CVCL_0023 | |
NCI-H441 cells | Lung | Homo sapiens (Human) | CVCL_1561 | |
H2172 cells | Lung | Homo sapiens (Human) | CVCL_1537 | |
H827 cells | Lung | Homo sapiens (Human) | N.A. | |
PC-14 cells | Lung | Homo sapiens (Human) | CVCL_1640 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Wound-healing and Transwell assay | |||
Mechanism Description | miR-424-3p was discovered to suppress the level of YAP1 protein by targeting its 3' untranslated region, suggesting that miR-424-3p could be a potential molecular target for treatment of NSCLC with chemoresistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Head and neck squamous cell carcinoma | [10] | |||
Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
Resistant Drug | Trametinib | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
RkO cells | Colon | Homo sapiens (Human) | CVCL_0504 | |
SH-1-V5 cells | Esophagus | Homo sapiens (Human) | N.A. | |
In Vivo Model | Patient-derived xenografts in female NSG mouse model | Mus musculus | ||
Mechanism Description | Yap1 Mediates Trametinib Resistance in Head and Neck Squamous Cell Carcinomas. This study identify a Yap1-dependent resistance to trametinib therapy in HNSCCs. Combined Yap1 and MEK targeting may represent a strategy to enhance HNSCC response. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [11] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Trastuzumab | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell invasion | Activation | hsa05200 | ||
Cell viability | Activation | hsa05200 | ||
In Vitro Model | SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay; Matrigel Invasion assay | |||
Mechanism Description | UCA1 knockdown upregulated miR-18a and downregulated YAP1 in breast cancer cells, restoring sensitivity of breast cancer cells to trastuzumab. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [11] | |||
Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
Sensitive Drug | Trastuzumab | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell invasion | Inhibition | hsa05200 | ||
Cell viability | Inhibition | hsa05200 | ||
In Vitro Model | SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay; Matrigel Invasion assay | |||
Mechanism Description | UCA1 knockdown upregulated miR-18a and downregulated YAP1 in breast cancer cells, restoring sensitivity of breast cancer cells to trastuzumab. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Prostate cancer | [12] | |||
Sensitive Disease | Prostate cancer [ICD-11: 2C82.0] | |||
Sensitive Drug | Verteporfin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | HEp-2 cells | Skin | Homo sapiens (Human) | CVCL_1906 |
U251 cells | Brain | Homo sapiens (Human) | CVCL_0021 | |
BT474 cells | Breast | Homo sapiens (Human) | CVCL_0179 | |
A172 cells | Brain | Homo sapiens (Human) | CVCL_0131 | |
U87 cells | Brain | Homo sapiens (Human) | CVCL_0022 | |
H1299 cells | Lung | Homo sapiens (Human) | CVCL_0060 | |
Calu-3 cells | Lung | Homo sapiens (Human) | CVCL_0609 | |
HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | |
In Vivo Model | Male BALB/c nude mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blotting analysis; qRT-PCR | |||
Experiment for Drug Resistance |
WST-1 assay; Colony formation assay; Annexin V-FITC/PI Apoptosis assay | |||
Mechanism Description | MYBL2 expression was significantly upregulated in CRPC tissues and cell lines. Overexpression of MYBL2 could facilitate castration-resistant growth and metastatic capacity in androgen-dependent PCa cells by promoting YAP1 transcriptional activity via modulating the activity of the Rho GTPases RhoA and LATS1 kinase. Importantly, targeting MYBL2, or treatment with either the YAP/TAZ inhibitor Verteporfin or the RhoA inhibitor Simvastatin, reversed the resistance to ADT and blocked bone metastasis in CRPC cells. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Esophagus | |
The Specified Disease | Esophageal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.81E-06; Fold-change: -1.16E+00; Z-score: -5.51E+00 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Liver | |
The Specified Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.58E-03; Fold-change: 3.63E-01; Z-score: 5.39E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.18E-18; Fold-change: 4.23E-01; Z-score: 8.82E-01 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 7.60E-02; Fold-change: 1.64E-01; Z-score: 1.13E+00 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Lung | |
The Specified Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.93E-18; Fold-change: -2.49E-01; Z-score: -6.38E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.27E-08; Fold-change: -4.57E-01; Z-score: -7.06E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.58E-47; Fold-change: -6.52E-01; Z-score: -9.93E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.26E-06; Fold-change: -4.78E-01; Z-score: -7.14E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Prostate | |
The Specified Disease | Prostate cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.45E-03; Fold-change: 2.28E-03; Z-score: 5.29E-03 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.