Molecule Information
General Information of the Molecule (ID: Mol01010)
Name |
Multidrug efflux SMR transporter (ABES)
,Acinetobacter baumannii
|
||||
---|---|---|---|---|---|
Synonyms |
abeS; emrE_2; A7M90_04670; CBE85_00325; CSB70_2397; FJU36_01990; G3N53_09785; ITE13_14185; NCTC13305_03610; Multidrug efflux SMR transporter AbeS; QacE family quaternary ammonium compound efflux SMR transporter; QacEdelta1 SMR family efflux pump; Small Multidrug Resistance family protein; Transporter
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
abeS
|
||||
Gene ID | |||||
Sequence |
MSYLYLAIAIACEVIATSALKASQGFTIPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYA
IWSGAGIILISAIGWIFYKQHLDLAACIGLALMIAGIVIINVFSKNTHL Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Amikacin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
Ciprofloxacin XR
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
Erythromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
Norfloxacin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Norfloxacin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
Novobiocin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Novobiocin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
Tetracycline
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
Trimethoprim
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Acinetobacter baumannii infection | [1] | |||
Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Experiment for Molecule Alteration |
Fluorometric efflux assay | |||
Experiment for Drug Resistance |
Broth dilution assay | |||
Mechanism Description | The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.