Molecule Information

General Information of the Molecule (ID: Mol01010)

• Name: Multidrug efflux SMR transporter (ABES) ,Acinetobacter baumannii
• Synonyms: abeS; emrE_2; A7M90_04670; CBE85_00325; CSB70_2397; FJU36_01990; G3N53_09785; ITE13_14185; NCTC13305_03610; Multidrug efflux SMR transporter AbeS; QacE family quaternary ammonium compound efflux SMR transporter; QacEdelta1 SMR family efflux pump; Small Multidrug Resistance family protein; Transporter
• Molecule Type: Protein
• Gene Name: abeS
• Gene ID: 66396571
• Sequence:
  MSYLYLAIAIACEVIATSALKASQGFTIPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYA
  IWSGAGIILISAIGWIFYKQHLDLAACIGLALMIAGIVIINVFSKNTHL
• Uniprot ID: A0A090B1X4_ACIBA

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 7 drug(s) in total

Amikacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Amikacin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

Ciprofloxacin XR

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Ciprofloxacin XR
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

Erythromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Erythromycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

Norfloxacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Norfloxacin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

Novobiocin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Novobiocin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

Tetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

Trimethoprim

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Acinetobacter baumannii infection [1]

• Resistant Disease: Acinetobacter baumannii infection [ICD-11: CA40.4]
• Resistant Drug: Trimethoprim
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli kAM32; 562
• Experiment for Molecule Alteration: Fluorometric efflux assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.

References

• Ref 1: Role of AbeS, a novel efflux pump of the SMR family of transporters, in resistance to antimicrobial agents in Acinetobacter baumannii. Antimicrob Agents Chemother. 2009 Dec;53(12):5312-6. doi: 10.1128/AAC.00748-09. Epub 2009 Sep 21.