General Information of the Molecule (ID: Mol01166)
Name
Pyruvate decarboxylase 5 (PDC5) ,Pseudomonas aeruginosa
Molecule Type
Protein
Gene Name
PDC5
Sequence
MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISL
KGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWP
ALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNP
SIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVG
PGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEA
YDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRD
LGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Click to Show/Hide the Full List of Drugs
Aztreonam
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Aztreonam
Molecule Alteration Missense mutation
p.R79Q+p.T105A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Pseudomonas aeruginosa isolates 287
Pseudomonas aeruginosa PAO1 208964
Pseudomonas aeruginosa 12B 287
Pseudomonas aeruginosa kG2505 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay; Etest method assay
Mechanism Description Reduced susceptibility to imipenem, ceftazidime, and cefepime was observed only with recombinant P. aeruginosa strains expressing an AmpC Beta-lactamase that had an alanine residue at position 105.Recently, several ESACs have been described from Escherichia coli contributing to reduced susceptibility to imipenem.
Cefepime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefepime
Molecule Alteration Missense mutation
p.R79Q+p.T105A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Pseudomonas aeruginosa isolates 287
Pseudomonas aeruginosa PAO1 208964
Pseudomonas aeruginosa 12B 287
Pseudomonas aeruginosa kG2505 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay; Etest method assay
Mechanism Description Reduced susceptibility to imipenem, ceftazidime, and cefepime was observed only with recombinant P. aeruginosa strains expressing an AmpC Beta-lactamase that had an alanine residue at position 105.Recently, several ESACs have been described from Escherichia coli contributing to reduced susceptibility to imipenem.
Cefpirome
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefpirome
Molecule Alteration Missense mutation
p.R79Q+p.T105A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Pseudomonas aeruginosa isolates 287
Pseudomonas aeruginosa PAO1 208964
Pseudomonas aeruginosa 12B 287
Pseudomonas aeruginosa kG2505 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay; Etest method assay
Mechanism Description Reduced susceptibility to imipenem, ceftazidime, and cefepime was observed only with recombinant P. aeruginosa strains expressing an AmpC Beta-lactamase that had an alanine residue at position 105.Recently, several ESACs have been described from Escherichia coli contributing to reduced susceptibility to imipenem.
Ceftazidime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ceftazidime
Molecule Alteration Missense mutation
p.R79Q+p.T105A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Pseudomonas aeruginosa isolates 287
Pseudomonas aeruginosa PAO1 208964
Pseudomonas aeruginosa 12B 287
Pseudomonas aeruginosa kG2505 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay; Etest method assay
Mechanism Description Reduced susceptibility to imipenem, ceftazidime, and cefepime was observed only with recombinant P. aeruginosa strains expressing an AmpC Beta-lactamase that had an alanine residue at position 105.Recently, several ESACs have been described from Escherichia coli contributing to reduced susceptibility to imipenem.
Meropenem
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Meropenem
Molecule Alteration Missense mutation
p.R79Q+p.T105A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Pseudomonas aeruginosa isolates 287
Pseudomonas aeruginosa PAO1 208964
Pseudomonas aeruginosa 12B 287
Pseudomonas aeruginosa kG2505 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay; Etest method assay
Mechanism Description Reduced susceptibility to imipenem, ceftazidime, and cefepime was observed only with recombinant P. aeruginosa strains expressing an AmpC Beta-lactamase that had an alanine residue at position 105.Recently, several ESACs have been described from Escherichia coli contributing to reduced susceptibility to imipenem.
Imipenem
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Imipenem
Molecule Alteration Missense mutation
p.R79Q+p.T105A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Pseudomonas aeruginosa isolates 287
Pseudomonas aeruginosa PAO1 208964
Pseudomonas aeruginosa 12B 287
Pseudomonas aeruginosa kG2505 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay; Etest method assay
Mechanism Description Reduced susceptibility to imipenem, ceftazidime, and cefepime was observed only with recombinant P. aeruginosa strains expressing an AmpC Beta-lactamase that had an alanine residue at position 105.Recently, several ESACs have been described from Escherichia coli contributing to reduced susceptibility to imipenem.
References
Ref 1 Extended-spectrum cephalosporinases in Pseudomonas aeruginosa. Antimicrob Agents Chemother. 2009 May;53(5):1766-71. doi: 10.1128/AAC.01410-08. Epub 2009 Mar 2.
Ref 2 Identifying novel Beta-lactamase substrate activity through in silico prediction of antimicrobial resistance. Microb Genom. 2021 Jan;7(1):mgen000500. doi: 10.1099/mgen.0.000500.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.