Molecule Information

General Information of the Molecule (ID: Mol01064)
Name
Quinolone resistance protein NorB (NORB) ,Staphylococcus aureus
Synonyms
SAOUHSC_01448
    Click to Show/Hide
Molecule Type
Protein
Gene Name
norB
Gene ID
3920226
Sequence
MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM
PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI
ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLSLNILITKGSELGVTSLLFITLLAIA
IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS
SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEIFYV
ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY
AIVSNMTNIYTGAMIALWLNAGMGILSFVIILLLVPKQNDTQL
    Click to Show/Hide
Function
Multidrug efflux pump that acts independently of NorA and is one of the factors that confers resistance against diverse quinolones and chemical compounds. Extrudes norfloxacin, ciprofloxacin, cetrimide, tetraphenylphosphonium ion (TPP), sparfloxacin, moxifloxacin and ethidium bromide. Contributes also to the efflux of tetracycline.
    Click to Show/Hide
Uniprot ID
NORB_STAA8
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Staphylococcus
Species: Staphylococcus aureus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
Moxifloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Moxifloxacin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
Sparfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Sparfloxacin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cetrimide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Cetrimide
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
Investigative Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Homidium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Homidium bromide
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
Quinolones
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
 Disease Info 
Resistant Drug Quinolones
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Experiment for
Molecule Alteration		 DNA microarray hybridization assay
Experiment for
Drug Resistance		 Serial twofold agar dilutions assay
Mechanism Description MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant.
References
Ref 1 MgrA is a multiple regulator of two new efflux pumps in Staphylococcus aureus. J Bacteriol. 2005 Apr;187(7):2395-405. doi: 10.1128/JB.187.7.2395-2405.2005.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.