Molecule Information

General Information of the Molecule (ID: Mol01007)
Name
MsrC (MSRC) ,Enterococcus faecium
Synonyms
msrC; Fragment
    Click to Show/Hide
Molecule Type
Protein
Gene Name
msrC
Sequence
FWHQLELSIDSLRVYQQDRIGIIGENGVGKSTLLKLIAGELFPDHGKIQTEITFNYLPQL
TYLAEAKDLNLELASHFQLRLEETSERKWSGGEERKIELIRLLSSYEQGMLLDEPTTHLD
RKSIDRLIEELRYYYGTLVFVSHDRYFLDELATKIWEVKDGEIREFSGNYSAYLTQKELE
KKTQLREAESIMKEKKRLEKSIQEKKKQAEKLEKVSSKKKKQQIRPDRLSSSKQKDSVQK
AIQKNAKTLERKLQKIGETTKPQQMKQIRFPVPKSLELHSRYPIMGQNVQLERSGRTLLV
NGDFQFSLGKKIAIVGENGSGKTTLLEHIRKQGEGILLSPKVSFQVYQQKDYQMTSEESV
IRFVMRQTEFSESLVRSLLNHLGFAQETLAKPLCTLSGGEATRLTIALLFTKPSNVLLLD
EPTNFIDMATIEALEKLMQIYPGTILFTSHDSYFVERTADEV
    Click to Show/Hide
Uniprot ID
A0A0H3XSR7_ENTFC
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Erythromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Resistant Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Resistant Drug Erythromycin
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description The complete sequence (1,479 nucleotides) of msrC, part of which was recently reported by others using a different strain, was determined. This gene was found in 233 of 233 isolates of Enterococcus faecium but in none of 265 other enterococci. Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci. This endogenous, species-specific gene of E. faecium is 53% identical to msr(A), suggesting that it may be a remote progenitor of the acquired macrolide resistance gene found in some isolates of staphylococci.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Sensitive Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Sensitive Drug Erythromycin
 Drug Info 
Molecule Alteration Truncated mutantion
Disruption (nt 1251 to 1879)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci.
Macrolides
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Resistant Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Resistant Drug Macrolides
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description The complete sequence (1,479 nucleotides) of msrC, part of which was recently reported by others using a different strain, was determined. This gene was found in 233 of 233 isolates of Enterococcus faecium but in none of 265 other enterococci. Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci. This endogenous, species-specific gene of E. faecium is 53% identical to msr(A), suggesting that it may be a remote progenitor of the acquired macrolide resistance gene found in some isolates of staphylococci.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Sensitive Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Sensitive Drug Macrolides
 Drug Info 
Molecule Alteration Truncated mutantion
Disruption (nt 1251 to 1879)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci.
Quinupristin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Resistant Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Resistant Drug Quinupristin
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description The complete sequence (1,479 nucleotides) of msrC, part of which was recently reported by others using a different strain, was determined. This gene was found in 233 of 233 isolates of Enterococcus faecium but in none of 265 other enterococci. Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci. This endogenous, species-specific gene of E. faecium is 53% identical to msr(A), suggesting that it may be a remote progenitor of the acquired macrolide resistance gene found in some isolates of staphylococci.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Sensitive Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Sensitive Drug Quinupristin
 Drug Info 
Molecule Alteration Truncated mutantion
Disruption (nt 1251 to 1879)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci.
Zithromax
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Resistant Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Resistant Drug Zithromax
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description The complete sequence (1,479 nucleotides) of msrC, part of which was recently reported by others using a different strain, was determined. This gene was found in 233 of 233 isolates of Enterococcus faecium but in none of 265 other enterococci. Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci. This endogenous, species-specific gene of E. faecium is 53% identical to msr(A), suggesting that it may be a remote progenitor of the acquired macrolide resistance gene found in some isolates of staphylococci.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcus faecium meningitis [1]
Sensitive Disease Enterococcus faecium meningitis [ICD-11: 1D01.2]
 Disease Info 
Sensitive Drug Zithromax
 Drug Info 
Molecule Alteration Truncated mutantion
Disruption (nt 1251 to 1879)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Enterococcus faecium TX2465 1352
Escherichia coli TX1330 668369
Escherichia coli TX2046 668369
Escherichia coli TX2597 668369
Experiment for
Molecule Alteration		 Southern blotting assay
Experiment for
Drug Resistance		 Twofold dilutions assay
Mechanism Description Disruption of msrC was associated with a two- to eightfold decrease in MICs of erythromycin azithromycin, tylosin, and quinupristin, suggesting that it may explain in part the apparent greater intrinsic resistance to macrolides of isolates of E. faecium relative to many streptococci.
References
Ref 1 Disruption of an Enterococcus faecium species-specific gene, a homologue of acquired macrolide resistance genes of staphylococci, is associated with an increase in macrolide susceptibility. Antimicrob Agents Chemother. 2001 Jan;45(1):263-6. doi: 10.1128/AAC.45.1.263-266.2001.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.