Molecule Information
General Information of the Molecule (ID: Mol00960)
Name |
Erythromycin resistance protein (ERM38)
,Mycolicibacterium smegmatis
|
||||
---|---|---|---|---|---|
Synonyms |
erm(38); 38
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
erm(38)
|
||||
Sequence |
MSTPHHGRHELGQNFLSDRRVIADIVEIVSRTNGPIIEIGAGDGALTIPLQRLARPLTAV
EVDARRARRLAQRTARSAPGPASRPTEVVAADFLRYPLPRSPHVVVGNLPFHLTTAILRR LLHGPGWTTAVLLMQWEVARRRAAVGGATMMTAQWWPWFEFGLARKVSAASFTPRPAVDA GLLTITRRSRPLVDVADRARYQALVHRVFTGRGHGMAQILQRLPTPVPRTWLRANGIAPN SLPRQLSAAQWAALFEQTRLTGAQRVDRPRDVQHGRAHRRRGGEVDRPATHHKQTGPVVG QRQPQRGRDADADPDDQRTAPPVTRHHQGERRDEDQADHQDRPLTGEHLAGEFLWRHASF DSSASTTLVSRKARVNGPTPPGLGDT Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Clarithromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Clarithromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Clarithromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. |
Clindamycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Clindamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Clindamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. |
Erythromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. |
Quinupristin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Quinupristin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Quinupristin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. |
Telithromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Telithromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
Disease Class: Mycobacterium smegmatis infection | [1] | |||
Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
Resistant Drug | Telithromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.