Molecule Information

General Information of the Molecule (ID: Mol00958)
Name
Erythromycin esterase (EREA2) ,Vibrio cholerae
Synonyms
ereA2; Erythromycin esterase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
ereA2
Sequence
MTWRTTRTLLQPQKLEFNEFEILNPVVEGARIVGIGEGAHFVAEFSLARASLIRYFVERH
DFNAIGLECGAIQASRLSEWLNSTAGAHELERFSDTLTFSLYGSVLIWVKSYLRESGRKL
QLVGIDLPNTLNPRDDLAQLAEIIQVIDHLMKPHVDALTQLLTSIDGQSAVISSAKWGEL
ETAQQEKAISGVTRLKLRLASLAPVLKNHVNSDFFRKASDRIESIEYTLETLRVMKAFFD
GTSLEGDTSVRDSYMAGVVDGMVRANPDVRIILLAHNNHLQKTPVSFSGELTAVPMGQHL
AEREEGDYRAIAFTHLGLTVPEMHFPSPDSPLGFSVVTTPADAIREDSVEQYVIDACGKE
DSCLTLTDDPMEAKRMRSQSASVETNLSEAFDAIVCVPSAGKDSLVAL
    Click to Show/Hide
Uniprot ID
Q7B6B2_VIBCL
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Vibrionales
Family: Vibrionaceae
Genus: Vibrio
Species: Vibrio cholerae
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ampicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Ampicillin
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Vibrio cholerae PG170 666
Vibrio cholerae PL96 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
Chloramphenicol
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Chloramphenicol
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Vibrio cholerae PG170 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
Furazolidone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Furazolidone
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Vibrio cholerae PG170 666
Vibrio cholerae PL96 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
Nalidixic acid
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Vibrio cholerae PG170 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
Trimethoprim
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Trimethoprim
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Vibrio cholerae PG170 666
Vibrio cholerae PL96 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Sulfamethizole/Sulfadiazine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
 Disease Info 
Resistant Drug Sulfamethizole/Sulfadiazine
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae PG153/1 666
Vibrio cholerae PG170 666
Vibrio cholerae PL96 666
Experiment for
Molecule Alteration		 PCR and DNA sequencing assay
Experiment for
Drug Resistance		 Commercial antimicrobial discs assay
Mechanism Description The expression of dfrA5, ereA2 lead to drug resistance.
References
Ref 1 Occurrence of antibiotic resistance gene cassettes aac(6')-Ib, dfrA5, dfrA12, and ereA2 in class I integrons in non-O1, non-O139 Vibrio cholerae strains in India. Antimicrob Agents Chemother. 2002 Sep;46(9):2948-55. doi: 10.1128/AAC.46.9.2948-2955.2002.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.