Molecule Information

General Information of the Molecule (ID: Mol04347)
Name
Cysteine and glycine-rich protein 1 (CSRP1) ,Homo sapiens
Synonyms
Cysteine-rich protein 1; Epididymis luminal protein 141
    Click to Show/Hide
Molecule Type
Protein
Gene Name
CSRP1
Gene ID
1465
Sequence
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERC
P RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPK
GF GFGQGAGALVHSE
    Click to Show/Hide
Function
Could play a role in neuronal development.
    Click to Show/Hide
Uniprot ID
CSRP1_HUMAN
Ensembl ID
ENSG0000015917614
HGNC ID
HGNC:2469
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [1]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
 Disease Info 
Sensitive Drug Cisplatin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
Cell Pathway Regulation Rap1 signaling pathway Activation hsa04015
HIF-1 signaling pathway Activation hsa04066
JAK-STAT signaling pathway Activation hsa04630
In Vivo Model Patient-derived advanced AML model Homo sapiens
Experiment for
Drug Resistance		 OncoPredict assay
Mechanism Description Based on the findings, the high?CSRP1?groups of patients in the TCGA datasets showed higher sensitivity to 5-fluorouracil, gemcitabine, rapamycin, and cisplatin and lower sensitivity to fludarabine. CSRP1 may serve as a potential prognostic marker and a therapeutic target for AML in the future.
Fludarabine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [1]
Resistant Disease Acute myeloid leukemia [ICD-11: 2A60.0]
 Disease Info 
Resistant Drug Fludarabine
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
Cell Pathway Regulation Rap1 signaling pathway Activation hsa04015
HIF-1 signaling pathway Activation hsa04066
JAK-STAT signaling pathway Activation hsa04630
In Vivo Model Patient-derived advanced AML model Homo sapiens
Experiment for
Drug Resistance		 OncoPredict assay
Mechanism Description Based on the findings, the high?CSRP1?groups of patients in the TCGA datasets showed higher sensitivity to 5-fluorouracil, gemcitabine, rapamycin, and cisplatin and lower sensitivity to fludarabine. CSRP1 may serve as a potential prognostic marker and a therapeutic target for AML in the future.
Fluorouracil
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [1]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
 Disease Info 
Sensitive Drug Fluorouracil
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
Cell Pathway Regulation Rap1 signaling pathway Activation hsa04015
HIF-1 signaling pathway Activation hsa04066
JAK-STAT signaling pathway Activation hsa04630
In Vivo Model Patient-derived advanced AML model Homo sapiens
Experiment for
Drug Resistance		 OncoPredict assay
Mechanism Description Based on the findings, the high?CSRP1?groups of patients in the TCGA datasets showed higher sensitivity to 5-fluorouracil, gemcitabine, rapamycin, and cisplatin and lower sensitivity to fludarabine. CSRP1 may serve as a potential prognostic marker and a therapeutic target for AML in the future.
Gemcitabine
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [1]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
 Disease Info 
Sensitive Drug Gemcitabine
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
Cell Pathway Regulation Rap1 signaling pathway Activation hsa04015
HIF-1 signaling pathway Activation hsa04066
JAK-STAT signaling pathway Activation hsa04630
In Vivo Model Patient-derived advanced AML model Homo sapiens
Experiment for
Drug Resistance		 OncoPredict assay
Mechanism Description Based on the findings, the high?CSRP1?groups of patients in the TCGA datasets showed higher sensitivity to 5-fluorouracil, gemcitabine, rapamycin, and cisplatin and lower sensitivity to fludarabine. CSRP1 may serve as a potential prognostic marker and a therapeutic target for AML in the future.
Sirolimus
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [1]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
 Disease Info 
Sensitive Drug Sirolimus
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
Cell Pathway Regulation Rap1 signaling pathway Activation hsa04015
HIF-1 signaling pathway Activation hsa04066
JAK-STAT signaling pathway Activation hsa04630
In Vivo Model Patient-derived advanced AML model Homo sapiens
Experiment for
Drug Resistance		 OncoPredict assay
Mechanism Description Based on the findings, the high?CSRP1?groups of patients in the TCGA datasets showed higher sensitivity to 5-fluorouracil, gemcitabine, rapamycin, and cisplatin and lower sensitivity to fludarabine. CSRP1 may serve as a potential prognostic marker and a therapeutic target for AML in the future.
References
Ref 1 Cysteine- and glycine-rich protein 1 predicts prognosis and therapy response in patients with acute myeloid leukemia. Clin Exp Med. 2024 Mar 28;24(1):57.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.