Molecule Information

General Information of the Molecule (ID: Mol01000)

• Name: Melanoma antigen A 4 (MAGE4) ,Homo sapiens
• Synonyms: MAGEA4; MAGEA4); mRNA
• Molecule Type: Protein
• Gene Name: MAGEA4
• Sequence:
  MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESA
  GPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHF
  LLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLV
  TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVY
  GEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI
  AYPSLREAALLEEEEGV
• Uniprot ID: Q1RN33_HUMAN

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 4 drug(s) in total

Carboplatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Retinoblastoma [1]

• Sensitive Disease: Retinoblastoma [ICD-11: 2D02.2]
• Sensitive Drug: Carboplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: MAGE-A/p53 signaling pathway; Regulation; hsa04115
• In Vitro Model: HXO-Rb44 cells; Retina; Homo sapiens (Human); CVCL_D542
• In Vitro Model: SO-Rb50 cells; Retina; Homo sapiens (Human); CVCL_D543
• In Vitro Model: WERI-Rb-1 cells; Retina; Homo sapiens (Human); CVCL_1792
• In Vitro Model: Y79 cells; Retina; Homo sapiens (Human); CVCL_1893
• Experiment for Molecule Alteration: Western blot analysis; RT-qPCR
• Experiment for Drug Resistance: Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
• Mechanism Description: miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).

Doxorubicin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Retinoblastoma [1]

• Sensitive Disease: Retinoblastoma [ICD-11: 2D02.2]
• Sensitive Drug: Doxorubicin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: MAGE-A/p53 signaling pathway; Regulation; hsa04115
• In Vitro Model: HXO-Rb44 cells; Retina; Homo sapiens (Human); CVCL_D542
• In Vitro Model: SO-Rb50 cells; Retina; Homo sapiens (Human); CVCL_D543
• In Vitro Model: WERI-Rb-1 cells; Retina; Homo sapiens (Human); CVCL_1792
• In Vitro Model: Y79 cells; Retina; Homo sapiens (Human); CVCL_1893
• Experiment for Molecule Alteration: Western blot analysis; RT-qPCR
• Experiment for Drug Resistance: Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
• Mechanism Description: miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).

Etoposide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Retinoblastoma [1]

• Sensitive Disease: Retinoblastoma [ICD-11: 2D02.2]
• Sensitive Drug: Etoposide
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: MAGE-A/p53 signaling pathway; Regulation; hsa04115
• In Vitro Model: HXO-Rb44 cells; Retina; Homo sapiens (Human); CVCL_D542
• In Vitro Model: SO-Rb50 cells; Retina; Homo sapiens (Human); CVCL_D543
• In Vitro Model: WERI-Rb-1 cells; Retina; Homo sapiens (Human); CVCL_1792
• In Vitro Model: Y79 cells; Retina; Homo sapiens (Human); CVCL_1893
• Experiment for Molecule Alteration: Western blot analysis; RT-qPCR
• Experiment for Drug Resistance: Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
• Mechanism Description: miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).

Vincristine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Retinoblastoma [1]

• Sensitive Disease: Retinoblastoma [ICD-11: 2D02.2]
• Sensitive Drug: Vincristine
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: MAGE-A/p53 signaling pathway; Regulation; hsa04115
• In Vitro Model: HXO-Rb44 cells; Retina; Homo sapiens (Human); CVCL_D542
• In Vitro Model: SO-Rb50 cells; Retina; Homo sapiens (Human); CVCL_D543
• In Vitro Model: WERI-Rb-1 cells; Retina; Homo sapiens (Human); CVCL_1792
• In Vitro Model: Y79 cells; Retina; Homo sapiens (Human); CVCL_1893
• Experiment for Molecule Alteration: Western blot analysis; RT-qPCR
• Experiment for Drug Resistance: Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
• Mechanism Description: miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).

References

• Ref 1: miR 34a regulates the chemosensitivity of retinoblastoma cells via modulation of MAGE A/p53 signaling. Int J Oncol. 2019 Jan;54(1):177-187. doi: 10.3892/ijo.2018.4613. Epub 2018 Oct 31.