Molecule Information
      General Information of the Molecule (ID: Mol01000)
  
  | Name | 
               Melanoma antigen A 4 (MAGE4)
                                ,Homo sapiens
                               
             | 
          ||||
|---|---|---|---|---|---|
| Synonyms | 
           MAGEA4; MAGEA4); mRNA 
              Click to Show/Hide 
           | 
        ||||
| Molecule Type | 
             Protein 
           | 
        ||||
| Gene Name | 
             MAGEA4 
           | 
        ||||
| Sequence | 
               MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESA 
              GPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHF LLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLV TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVY GEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI AYPSLREAALLEEEEGV     Click to Show/Hide 
         | 
        ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      4 drug(s) in total
      
    | Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
| 
                
             | 
          
        ||||
| Disease Class: Retinoblastoma | [1] | |||
| Sensitive Disease | Retinoblastoma [ICD-11: 2D02.2] | |||
| Sensitive Drug | Carboplatin | |||
| Molecule Alteration | Expression | Up-regulation  | 
          ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| MAGE-A/p53 signaling pathway | Regulation | hsa04115 | ||
| In Vitro Model | HXO-Rb44 cells | Retina | Homo sapiens (Human) | CVCL_D542 | 
| SO-Rb50 cells | Retina | Homo sapiens (Human) | CVCL_D543 | |
| WERI-Rb-1 cells | Retina | Homo sapiens (Human) | CVCL_1792 | |
| Y79 cells | Retina | Homo sapiens (Human) | CVCL_1893 | |
| Experiment for Molecule Alteration  | 
            Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance  | 
            Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay | |||
| Mechanism Description | miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine). | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
| 
                
             | 
          
        ||||
| Disease Class: Retinoblastoma | [1] | |||
| Sensitive Disease | Retinoblastoma [ICD-11: 2D02.2] | |||
| Sensitive Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Up-regulation  | 
          ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| MAGE-A/p53 signaling pathway | Regulation | hsa04115 | ||
| In Vitro Model | HXO-Rb44 cells | Retina | Homo sapiens (Human) | CVCL_D542 | 
| SO-Rb50 cells | Retina | Homo sapiens (Human) | CVCL_D543 | |
| WERI-Rb-1 cells | Retina | Homo sapiens (Human) | CVCL_1792 | |
| Y79 cells | Retina | Homo sapiens (Human) | CVCL_1893 | |
| Experiment for Molecule Alteration  | 
            Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance  | 
            Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay | |||
| Mechanism Description | miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine). | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
| 
                
             | 
          
        ||||
| Disease Class: Retinoblastoma | [1] | |||
| Sensitive Disease | Retinoblastoma [ICD-11: 2D02.2] | |||
| Sensitive Drug | Etoposide | |||
| Molecule Alteration | Expression | Up-regulation  | 
          ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| MAGE-A/p53 signaling pathway | Regulation | hsa04115 | ||
| In Vitro Model | HXO-Rb44 cells | Retina | Homo sapiens (Human) | CVCL_D542 | 
| SO-Rb50 cells | Retina | Homo sapiens (Human) | CVCL_D543 | |
| WERI-Rb-1 cells | Retina | Homo sapiens (Human) | CVCL_1792 | |
| Y79 cells | Retina | Homo sapiens (Human) | CVCL_1893 | |
| Experiment for Molecule Alteration  | 
            Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance  | 
            Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay | |||
| Mechanism Description | miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine). | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
| 
                
             | 
          
        ||||
| Disease Class: Retinoblastoma | [1] | |||
| Sensitive Disease | Retinoblastoma [ICD-11: 2D02.2] | |||
| Sensitive Drug | Vincristine | |||
| Molecule Alteration | Expression | Up-regulation  | 
          ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| MAGE-A/p53 signaling pathway | Regulation | hsa04115 | ||
| In Vitro Model | HXO-Rb44 cells | Retina | Homo sapiens (Human) | CVCL_D542 | 
| SO-Rb50 cells | Retina | Homo sapiens (Human) | CVCL_D543 | |
| WERI-Rb-1 cells | Retina | Homo sapiens (Human) | CVCL_1792 | |
| Y79 cells | Retina | Homo sapiens (Human) | CVCL_1893 | |
| Experiment for Molecule Alteration  | 
            Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance  | 
            Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay | |||
| Mechanism Description | miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine). | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
