Molecule Information
General Information of the Molecule (ID: Mol00987)
Name |
Lincomycin resistance efflux pump (LMRS)
,Staphylococcus aureus
|
||||
---|---|---|---|---|---|
Synonyms |
lmrS; GZ128_11505; GZ156_01550; HCU70_08510; HUW54_11080; Multidrug efflux MFS transporter LmrS
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
lmrS
|
||||
Sequence |
MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIALVA FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALIISMV IIYLFIRRQFNITNALLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Superficial skin infection by Staphylococcus aureus infection | [1] | |||
Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32 | 562 | ||
Staphylococcus aureus OM505 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.