Molecule Information
General Information of the Molecule (ID: Mol00987)
| Name |
Lincomycin resistance efflux pump (LMRS)
,Staphylococcus aureus
|
||||
|---|---|---|---|---|---|
| Synonyms |
lmrS; GZ128_11505; GZ156_01550; HCU70_08510; HUW54_11080; Multidrug efflux MFS transporter LmrS
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
lmrS
|
||||
| Sequence |
MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIALVA FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALIISMV IIYLFIRRQFNITNALLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Florfenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Florfenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Florfenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Florfenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Florfenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Florfenicol | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Linezolid | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Linezolid | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Linezolid | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Linezolid | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Linezolid | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Linezolid | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | [1] | |||
| Resistant Disease | Superficial skin infection by Staphylococcus aureus infection [ICD-11: 1B21.3] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli kAM32 | 562 | ||
| Staphylococcus aureus OM505 | 1280 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | LmrS is a multidrug efflux pump of the major facilitator superfamily from staphylococcus aureus. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
