General Information of the Molecule (ID: Mol00701)
Name
Wee1-like protein kinase (WEE1) ,Homo sapiens
Synonyms
WEE1hu; Wee1A kinase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
WEE1
Gene ID
7465
Location
chr11:9573670-9593457[+]
Sequence
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
    Click to Show/Hide
3D-structure
PDB ID
1X8B
Classification
Transferase
Method
X-ray diffraction
Resolution
1.81  Å
Function
Acts as a negative regulator of entry into mitosis (G2 to M transition) by protecting the nucleus from cytoplasmically activated cyclin B1-complexed CDK1 before the onset of mitosis by mediating phosphorylation of CDK1 on 'Tyr-15'. Specifically phosphorylates and inactivates cyclin B1-complexed CDK1 reaching a maximum during G2 phase and a minimum as cells enter M phase. Phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15' and phosphorylation of monomeric CDK1 does not occur. Its activity increases during S and G2 phases and decreases at M phase when it is hyperphosphorylated. A correlated decrease in protein level occurs at M/G1 phase, probably due to its degradation.
    Click to Show/Hide
Uniprot ID
WEE1_HUMAN
Ensembl ID
ENSG00000166483
HGNC ID
HGNC:12761
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  RTDM: Regulation by the Disease Microenvironment
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Fluorouracil
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Kidney cancer [ICD-11: 2C90.1] [1]
Sensitive Disease Kidney cancer [ICD-11: 2C90.1]
Sensitive Drug Fluorouracil
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Kidney cancer [ICD-11: 2C90]
The Specified Disease Kidney cancer
The Studied Tissue Kidney
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.32E-08
Fold-change: -6.91E-01
Z-score: -6.01E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
Cell proliferation Inhibition hsa05200
WEE1/Cdc2 signaling pathway Activation hsa04110
In Vitro Model 786-O cells Kidney Homo sapiens (Human) CVCL_1051
HK-2 cells Kidney Homo sapiens (Human) CVCL_0302
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description miR-381 increases sensitivity of 786-O cells to 5-FU by inhibitory WEE1 and increase of Cdc2activity.
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Colon cancer [ICD-11: 2B90.1] [3]
Resistant Disease Colon cancer [ICD-11: 2B90.1]
Resistant Drug Fluorouracil
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Colon cancer [ICD-11: 2B90]
The Specified Disease Colon cancer
The Studied Tissue Colon tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 4.92E-41
Fold-change: 1.05E-01
Z-score: 1.63E+01
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HCT116 cells Colon Homo sapiens (Human) CVCL_0291
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay; Flow cytometric analysis
Mechanism Description Inhibition of miR195 sensitized resistant cells to 5-FU by downregulating WEE1 and CHk1.
Palbociclib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [2]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Palbociclib
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Breast cancer [ICD-11: 2C60]
The Specified Disease Breast cancer
The Studied Tissue Breast tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.38E-02
Fold-change: 2.39E-02
Z-score: 2.47E+00
Experimental Note Revealed Based on the Cell Line Data
Mechanism Description WEE1 plays an important role in the G2/M checkpoint. It inhibits the entry of DNA-damaged cells into mitosis in coordination with CDK1. Though the involvement of WEE1 in inducing resistance to CDK4/6 inhibitors is unknown, inhibition of WEE1 has been shown to increase sensitivity to CDK4/6 inhibitors in resistant cells. As WEE1 is associated with a resistant phenotype in preclinical models, targeting the G2/M phase via the inhibition of WEE1 in combination with CDK4/6 inhibition could be a therapeutic option in overcoming resistance.
Cisplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Epidermoid carcinoma [ICD-11: 2C31.Z] [4]
Sensitive Disease Epidermoid carcinoma [ICD-11: 2C31.Z]
Sensitive Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Skin squamous cell carcinoma [ICD-11: 2C31]
The Specified Disease Skin cancer
The Studied Tissue Skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 6.50E-11
Fold-change: -5.66E-02
Z-score: -6.67E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
In Vitro Model KB-3-1 cells Lung Homo sapiens (Human) CVCL_2088
KB-CP.5 cells Lung Homo sapiens (Human) CVCL_IP04
KB-CP20 cells Lung Homo sapiens (Human) CVCL_IP06
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description Overexpression of the cell cycle kinases WEE1 and CHk1 occurred commonly in cisplatin-resistant cells, miR-15/16/195/424/497 family sensitize cisplatin-resistant cells to apoptosis by targeting WEE1 and CHk1.
LY2835219
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [2]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug LY2835219
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Mechanism Description WEE1 plays an important role in the G2/M checkpoint. It inhibits the entry of DNA-damaged cells into mitosis in coordination with CDK1. Though the involvement of WEE1 in inducing resistance to CDK4/6 inhibitors is unknown, inhibition of WEE1 has been shown to increase sensitivity to CDK4/6 inhibitors in resistant cells. As WEE1 is associated with a resistant phenotype in preclinical models, targeting the G2/M phase via the inhibition of WEE1 in combination with CDK4/6 inhibition could be a therapeutic option in overcoming resistance.
Ribociclib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [2]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Ribociclib
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Mechanism Description WEE1 plays an important role in the G2/M checkpoint. It inhibits the entry of DNA-damaged cells into mitosis in coordination with CDK1. Though the involvement of WEE1 in inducing resistance to CDK4/6 inhibitors is unknown, inhibition of WEE1 has been shown to increase sensitivity to CDK4/6 inhibitors in resistant cells. As WEE1 is associated with a resistant phenotype in preclinical models, targeting the G2/M phase via the inhibition of WEE1 in combination with CDK4/6 inhibition could be a therapeutic option in overcoming resistance.
Temozolomide
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Glioma [ICD-11: 2A00.1] [5]
Sensitive Disease Glioma [ICD-11: 2A00.1]
Sensitive Drug Temozolomide
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model SNB19 cells Brain Homo sapiens (Human) CVCL_0535
T98G cells Brain Homo sapiens (Human) CVCL_0556
SNB19 TR cells Brain Homo sapiens (Human) CVCL_0535
T98G TR cells Brain Homo sapiens (Human) CVCL_0556
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT Assay; Wound healing assay; Transwell invasion assays
Mechanism Description miR26b reverses temozolomide resistance via targeting Wee1 in glioma cells. miR26b governed TR-mediate EMT partly due to governing its target Wee1.
Vincristine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Diffuse large B-cell lymphoma [ICD-11: 2A81.0] [6]
Resistant Disease Diffuse large B-cell lymphoma [ICD-11: 2A81.0]
Resistant Drug Vincristine
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model OCI-Ly7 cells N.A. Homo sapiens (Human) CVCL_1881
SU-DHL-5 cells N.A. Homo sapiens (Human) CVCL_1735
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Dose-response assays
Mechanism Description Down-regulation of miR-155 promotes vincristine resistance via upregulating Week1.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
MK1775
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Acute T-cell lymphocytic leukemia [ICD-11: 2A90.5] [7]
Sensitive Disease Acute T-cell lymphocytic leukemia [ICD-11: 2A90.5]
Sensitive Drug MK1775
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Jurkat cells Pleural effusion Homo sapiens (Human) CVCL_0065
CCRF-CEM cells Pleural effusion Homo sapiens (Human) CVCL_0207
MOLT4 cells Bone marrow Homo sapiens (Human) CVCL_0013
DND41 cells Pleural effusion Homo sapiens (Human) CVCL_2022
HPB-ALL cells Peripheral blood Homo sapiens (Human) CVCL_1820
CUTLL1 cells Pleural effusion Homo sapiens (Human) CVCL_4966
KOPTK1 cells N.A. Homo sapiens (Human) CVCL_4965
In Vivo Model NOD-Prkdcscid IL2Rgamma null NPG mice model Mus musculus
Experiment for
Molecule Alteration
Western blotting assay
Experiment for
Drug Resistance
CCK8 assay
Mechanism Description WEE1 inhibition sensitizes T-cell acute lymphoblastic leukemia cells to glutaminolysis inhibition.Elevated WEE1 expression driven by MYC poses the possibility that T-ALL cells may be particularly dependent on WEE1 for cell proliferation and survival. Indeed, a selective WEE1 inhibitor MK1775 as a single agent reduced cell viability in a dose-dependent manner in seven T-ALL cell lines, whereas the effect on normal BM cells was minimal.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00E+00; Fold-change: 2.69E+00; Z-score: 4.79E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.26E-02; Fold-change: 1.51E+00; Z-score: 3.26E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.77E-03; Fold-change: 7.74E-01; Z-score: 8.28E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.82E-09; Fold-change: 2.88E+00; Z-score: 5.50E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Colon
The Specified Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.92E-41; Fold-change: 5.36E-01; Z-score: 1.39E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.47E-31; Fold-change: 6.65E-01; Z-score: 1.37E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Skin squamous cell carcinoma [ICD-11: 2C31]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Skin
The Specified Disease Skin squamous cell carcinoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.50E-11; Fold-change: -3.83E-01; Z-score: -6.73E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.08E-14; Fold-change: -6.15E-01; Z-score: -8.53E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.38E-02; Fold-change: 1.14E-01; Z-score: 1.30E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.79E-01; Fold-change: -2.69E-01; Z-score: -2.33E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Kidney cancer [ICD-11: 2C90]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Kidney
The Specified Disease Kidney cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.46E-01; Fold-change: 2.80E-01; Z-score: 3.17E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.65E-04; Fold-change: 1.96E-01; Z-score: 3.19E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-381, a novel intrinsic WEE1 inhibitor, sensitizes renal cancer cells to 5-FU by up-regulation of Cdc2 activities in 786-O. J Chemother. 2013 Aug;25(4):229-38. doi: 10.1179/1973947813Y.0000000092. Epub 2013 May 7.
Ref 2 Molecular mechanisms of resistance to CDK4/6 inhibitors in breast cancer: A review .Int J Cancer. 2019 Sep 1;145(5):1179-1188. doi: 10.1002/ijc.32020. Epub 2019 Jan 7. 10.1002/ijc.32020
Ref 3 MicroRNA-195 desensitizes HCT116 human colon cancer cells to 5-fluorouracil. Cancer Lett. 2018 Jan 1;412:264-271. doi: 10.1016/j.canlet.2017.10.022. Epub 2017 Nov 5.
Ref 4 Cisplatin sensitivity mediated by WEE1 and CHK1 is mediated by miR-155 and the miR-15 family. Cancer Res. 2012 Nov 15;72(22):5945-55. doi: 10.1158/0008-5472.CAN-12-1400. Epub 2012 Aug 31.
Ref 5 MiR-26b reverses temozolomide resistance via targeting Wee1 in glioma cells. Cell Cycle. 2017 Oct 18;16(20):1954-1964. doi: 10.1080/15384101.2017.1367071. Epub 2017 Sep 12.
Ref 6 MicroRNA-155 controls vincristine sensitivity and predicts superior clinical outcome in diffuse large B-cell lymphoma. Blood Adv. 2019 Apr 9;3(7):1185-1196. doi: 10.1182/bloodadvances.2018029660.
Ref 7 WEE1 inhibition induces glutamine addiction in T-cell acute lymphoblastic leukemia .Haematologica. 2021 Jul 1;106(7):1816-1827. doi: 10.3324/haematol.2019.231126. 10.3324/haematol.2019.231126

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.