Molecule Information
      General Information of the Molecule (ID: Mol00450)
  
  | Name | Tyrosine-protein kinase JAK3 (JAK3)
                                ,Homo sapiens
                               | ||||
|---|---|---|---|---|---|
| Synonyms | Janus kinase 3; JAK-3; Leukocyte janus kinase; L-JAK     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | JAK3 | ||||
| Gene ID | |||||
| Location | chr19:17824780-17848071[-] | ||||
| Sequence | MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS     Click to Show/Hide | ||||
| Function | Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      3 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Neuroblastoma | [1] | |||
| Resistant Disease | Neuroblastoma [ICD-11: 2A00.11] | |||
| Resistant Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Down-regulation | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell metastasis | Activation | hsa05205 | ||
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | IMR-32 cells | Abdomen | Homo sapiens (Human) | CVCL_0346 | 
| Experiment for Molecule Alteration | Dual-luciferase reporter assay | |||
| Experiment for Drug Resistance | MTT assay; Flow cytometry assay | |||
| Mechanism Description | piR-39980 is an oncogenic piRNA overexpressed in NB cells which induces the cancer cell growth, enhance metastasis, and inhibit the cellular senescence by targeting JAk3 as well as desensitizes the chemotherapeutic drug. And piR-39980 was found to desensitize the effect of doxorubicin and inhibit drug-induced apoptosis. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Solid tumour/cancer | [2] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | Ruxolitinib | |||
| Molecule Alteration | Missense mutation | p.L857P (c.2570T>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| U4C cells | Acetabulum | Homo sapiens (Human) | CVCL_D314 | |
| In Vivo Model | Balb/c bone marrow transplantation mouse model | Mus musculus | ||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Proliferation assay | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Solid tumour/cancer | [2] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Ruxolitinib | |||
| Molecule Alteration | Missense mutation | p.V674A (c.2021T>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| U4C cells | Acetabulum | Homo sapiens (Human) | CVCL_D314 | |
| In Vivo Model | Balb/c bone marrow transplantation mouse model | Mus musculus | ||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Proliferation assay | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Solid tumour/cancer | [2] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.L857P (c.2570T>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| U4C cells | Acetabulum | Homo sapiens (Human) | CVCL_D314 | |
| In Vivo Model | Balb/c bone marrow transplantation mouse model | Mus musculus | ||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Proliferation assay | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.E183G (c.548A>G) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTT assay | |||
| Mechanism Description | The missense mutation p.E183G (c.548A>G) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [2] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.V674A (c.2021T>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| U4C cells | Acetabulum | Homo sapiens (Human) | CVCL_D314 | |
| In Vivo Model | Balb/c bone marrow transplantation mouse model | Mus musculus | ||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Proliferation assay | |||
| Disease Class: Mature T-cell and Nk-cell lymphoma | [4] | |||
| Sensitive Disease | Mature T-cell and Nk-cell lymphoma [ICD-11: 2B0Y.0] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.A572V (c.1715C>T) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NK-S1 cells | N.A. | . | N.A. | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTS assay | |||
| Mechanism Description | The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.A572V (c.1715C>T) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTT assay | |||
| Mechanism Description | The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.L156P (c.467T>C) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTT assay | |||
| Mechanism Description | The missense mutation p.L156P (c.467T>C) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.R172Q (c.515G>A) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTT assay | |||
| Mechanism Description | The missense mutation p.R172Q (c.515G>A) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [5] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.V722I (c.2164G>A) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Trypan blue exclusion assay | |||
|  | ||||
| Disease Class: Hematologic Cancer | [6] | |||
| Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.M511I (c.1533G>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293T cells | Kidney | Homo sapiens (Human) | CVCL_0063 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTS assay; FACS assay | |||
| Mechanism Description | Jak3 inhibitors CP-690,550 and NC1153 showed efficacy in reducing viability of Ba/F3 cells transformed with mutant forms of Jak3. | |||
| Disease Class: Hematologic Cancer | [6] | |||
| Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.A573V (c.1718C>T) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293T cells | Kidney | Homo sapiens (Human) | CVCL_0063 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTS assay; FACS assay | |||
| Mechanism Description | Jak3 inhibitors CP-690,550 and NC1153 showed efficacy in reducing viability of Ba/F3 cells transformed with mutant forms of Jak3. | |||
| Disease Class: Hematologic Cancer | [7] | |||
| Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.H583Y (c.1747C>T) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | JAKT/STAT signaling pathway | Inhibition | hsa04630 | |
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| NIH-3T3 cells | Embryo | Mus musculus (Mouse) | CVCL_0594 | |
| Experiment for Molecule Alteration | Immunohistochemistry assay; Immunoblotting assay | |||
| Experiment for Drug Resistance | CCK-8 assay | |||
| Mechanism Description | A STAT3 inhibitor was active against STAT3 -mutant SNK-6 and YT cells. Novel JAK3 mutations are oncogenic and druggable in NTCL. The JAK3 or STAT3 signal was altered in NTCL, and pathway inhibition might be a therapeutic option for patients with JAK3 - or STAT3 -mutant NTCL. | |||
| Disease Class: Hematologic Cancer | [7] | |||
| Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
| Sensitive Drug | Tofacitinib | |||
| Molecule Alteration | Missense mutation | p.G589D (c.1766G>A) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | JAKT/STAT signaling pathway | Inhibition | hsa04630 | |
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| NIH-3T3 cells | Embryo | Mus musculus (Mouse) | CVCL_0594 | |
| Experiment for Molecule Alteration | Immunohistochemistry assay; Immunoblotting assay | |||
| Experiment for Drug Resistance | CCK-8 assay | |||
| Mechanism Description | A STAT3 inhibitor was active against STAT3 -mutant SNK-6 and YT cells. Novel JAK3 mutations are oncogenic and druggable in NTCL. The JAK3 or STAT3 signal was altered in NTCL, and pathway inhibition might be a therapeutic option for patients with JAK3 - or STAT3 -mutant NTCL. | |||
Clinical Trial Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Acute myeloid leukemia | [8] | |||
| Resistant Disease | Acute myeloid leukemia [ICD-11: 2A60.0] | |||
| Resistant Drug | NS-018 | |||
| Molecule Alteration | Missense mutation | p.A572V (c.1715C>T) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | 
| Sf9 cells | Ovary | Homo sapiens (Human) | CVCL_0549 | |
| Experiment for Molecule Alteration | Colony formation assay | |||
| Experiment for Drug Resistance | MTT assay | |||
| Mechanism Description | The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the resistance of NS-018 by aberration of the drug's therapeutic target | |||
Preclinical Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Solid tumour/cancer | [2] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | NIBR3049 | |||
| Molecule Alteration | Missense mutation | p.V674A (c.2021T>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| U4C cells | Acetabulum | Homo sapiens (Human) | CVCL_D314 | |
| In Vivo Model | Balb/c bone marrow transplantation mouse model | Mus musculus | ||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Proliferation assay | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Solid tumour/cancer | [2] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | NIBR3049 | |||
| Molecule Alteration | Missense mutation | p.L857P (c.2570T>C) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | 
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| U4C cells | Acetabulum | Homo sapiens (Human) | CVCL_D314 | |
| In Vivo Model | Balb/c bone marrow transplantation mouse model | Mus musculus | ||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | Proliferation assay | |||
Investigative Drug(s)
      2 drug(s) in total
      
    | Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Solid tumour/cancer | [9] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | JANEX-1 | |||
| Molecule Alteration | Missense mutation | p.I87T (c.260T>C) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | 
| Experiment for Molecule Alteration | Immunoblotting analysis | |||
| Experiment for Drug Resistance | CCK-8 assay | |||
| Mechanism Description | The missense mutation p.I87T (c.260T>C) in gene JAK3 cause the sensitivity of JANEX-1 by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Lymphoma | [4] | |||
| Sensitive Disease | Lymphoma [ICD-11: 2A90- 2A85] | |||
| Sensitive Drug | Pyridone 6 | |||
| Molecule Alteration | Missense mutation | p.A572V (c.1715C>T) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NK-S1 cells | N.A. | . | N.A. | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTS assay | |||
| Mechanism Description | The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target | |||
| Disease Class: Acute myeloid leukemia | [9] | |||
| Sensitive Disease | Acute myeloid leukemia [ICD-11: 2A60.0] | |||
| Sensitive Drug | Pyridone 6 | |||
| Molecule Alteration | Missense mutation | p.Q501H (c.1503G>T) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | 
| Experiment for Molecule Alteration | Immunoblotting analysis | |||
| Experiment for Drug Resistance | CCK-8 assay | |||
| Mechanism Description | The missense mutation p.Q501H (c.1503G>T) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target | |||
| Disease Class: Acute myeloid leukemia | [9] | |||
| Sensitive Disease | Acute myeloid leukemia [ICD-11: 2A60.0] | |||
| Sensitive Drug | Pyridone 6 | |||
| Molecule Alteration | Missense mutation | p.R657Q (c.1970G>A) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | 
| Experiment for Molecule Alteration | Immunoblotting analysis | |||
| Experiment for Drug Resistance | CCK-8 assay | |||
| Mechanism Description | The missense mutation p.R657Q (c.1970G>A) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target | |||
| Disease Class: Lymphoma | [4] | |||
| Sensitive Disease | Lymphoma [ICD-11: 2A90- 2A85] | |||
| Sensitive Drug | Pyridone 6 | |||
| Molecule Alteration | Missense mutation | p.A573V (c.1718C>T) | ||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NK-S1 cells | N.A. | . | N.A. | 
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Experiment for Drug Resistance | MTS assay | |||
| Mechanism Description | The missense mutation p.A573V (c.1718C>T) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target | |||
| Disease Class: Acute myeloid leukemia | [9] | |||
| Sensitive Disease | Acute myeloid leukemia [ICD-11: 2A60.0] | |||
| Sensitive Drug | Pyridone 6 | |||
| Molecule Alteration | Missense mutation | p.I87T (c.260T>C) | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | 
| Experiment for Molecule Alteration | Immunoblotting analysis | |||
| Experiment for Drug Resistance | CCK-8 assay | |||
| Mechanism Description | The missense mutation p.I87T (c.260T>C) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target | |||
      Disease- and Tissue-specific Abundances of This Molecule
  
  
      ICD Disease Classification 02
       
    
    
  | Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Nervous tissue | |
| The Specified Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.61E-65; Fold-change: -2.32E-01; Z-score: -1.14E+00 | |
| Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals | ||
| Disease-specific Molecule Abundances |   | Click to View the Clearer Original Diagram | 
| The Studied Tissue | Brainstem tissue | |
| The Specified Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.83E-01; Fold-change: -1.41E-01; Z-score: -5.37E-01 | |
| Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals | ||
| Disease-specific Molecule Abundances |   | Click to View the Clearer Original Diagram | 
| The Studied Tissue | White matter | |
| The Specified Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.71E-08; Fold-change: -6.06E-01; Z-score: -3.92E+00 | |
| Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals | ||
| Disease-specific Molecule Abundances |   | Click to View the Clearer Original Diagram | 
| The Studied Tissue | Brainstem tissue | |
| The Specified Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.66E-03; Fold-change: -2.26E-01; Z-score: -9.71E-01 | |
| Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals | ||
| Disease-specific Molecule Abundances |   | Click to View the Clearer Original Diagram | 
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specified Disease | Acute myeloid leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.43E-05; Fold-change: 7.14E-02; Z-score: 3.37E-01 | |
| Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals | ||
| Disease-specific Molecule Abundances |   | Click to View the Clearer Original Diagram | 
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Tonsil tissue | |
| The Specified Disease | Lymphoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.40E-02; Fold-change: -2.14E-01; Z-score: -6.31E-01 | |
| Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals | ||
| Disease-specific Molecule Abundances |   | Click to View the Clearer Original Diagram | 
      
      Tissue-specific Molecule Abundances in Healthy Individuals
       
    
    
  |   | ||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
