General Information of the Molecule (ID: Mol00450)
Name
Tyrosine-protein kinase JAK3 (JAK3) ,Homo sapiens
Synonyms
Janus kinase 3; JAK-3; Leukocyte janus kinase; L-JAK
    Click to Show/Hide
Molecule Type
Protein
Gene Name
JAK3
Gene ID
3718
Location
chr19:17824780-17848071[-]
Sequence
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
    Click to Show/Hide
3D-structure
PDB ID
7Q6H
Classification
Signaling protein
Method
X-ray diffraction
Resolution
1.75  Å
Function
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.
    Click to Show/Hide
Uniprot ID
JAK3_HUMAN
Ensembl ID
ENSG00000105639
HGNC ID
HGNC:6193
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
  RTDM: Regulation by the Disease Microenvironment
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Doxorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Neuroblastoma [ICD-11: 2A00.11] [1]
Resistant Disease Neuroblastoma [ICD-11: 2A00.11]
Resistant Drug Doxorubicin
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Brain cancer
The Studied Tissue Nervous tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 2.61E-65
Fold-change: -6.47E-02
Z-score: -1.89E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
Cell metastasis Activation hsa05205
Cell proliferation Activation hsa05200
In Vitro Model IMR-32 cells Abdomen Homo sapiens (Human) CVCL_0346
Experiment for
Molecule Alteration
Dual-luciferase reporter assay
Experiment for
Drug Resistance
MTT assay; Flow cytometry assay
Mechanism Description piR-39980 is an oncogenic piRNA overexpressed in NB cells which induces the cancer cell growth, enhance metastasis, and inhibit the cellular senescence by targeting JAk3 as well as desensitizes the chemotherapeutic drug. And piR-39980 was found to desensitize the effect of doxorubicin and inhibit drug-induced apoptosis.
Ruxolitinib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Resistant Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Resistant Drug Ruxolitinib
Molecule Alteration Missense mutation
p.L857P (c.2570T>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293 cells Kidney Homo sapiens (Human) CVCL_0045
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
U4C cells Acetabulum Homo sapiens (Human) CVCL_D314
In Vivo Model Balb/c bone marrow transplantation mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Proliferation assay
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Ruxolitinib
Molecule Alteration Missense mutation
p.V674A (c.2021T>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293 cells Kidney Homo sapiens (Human) CVCL_0045
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
U4C cells Acetabulum Homo sapiens (Human) CVCL_D314
In Vivo Model Balb/c bone marrow transplantation mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Proliferation assay
Tofacitinib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.L857P (c.2570T>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293 cells Kidney Homo sapiens (Human) CVCL_0045
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
U4C cells Acetabulum Homo sapiens (Human) CVCL_D314
In Vivo Model Balb/c bone marrow transplantation mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Proliferation assay
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [3]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.E183G (c.548A>G)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description The missense mutation p.E183G (c.548A>G) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.V674A (c.2021T>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293 cells Kidney Homo sapiens (Human) CVCL_0045
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
U4C cells Acetabulum Homo sapiens (Human) CVCL_D314
In Vivo Model Balb/c bone marrow transplantation mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Proliferation assay
Disease Class: Mature T-cell and Nk-cell lymphoma [ICD-11: 2B0Y.0] [4]
Sensitive Disease Mature T-cell and Nk-cell lymphoma [ICD-11: 2B0Y.0]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.A572V (c.1715C>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model NK-S1 cells N.A. N.A. N.A.
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [3]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.A572V (c.1715C>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [3]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.L156P (c.467T>C)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description The missense mutation p.L156P (c.467T>C) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [3]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.R172Q (c.515G>A)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description The missense mutation p.R172Q (c.515G>A) in gene JAK3 cause the sensitivity of Tofacitinib by aberration of the drug's therapeutic target
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [5]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.V722I (c.2164G>A)
Experimental Note Identified from the Human Clinical Data
In Vitro Model K562 cells Blood Homo sapiens (Human) CVCL_0004
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Trypan blue exclusion assay
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Hematologic Cancer [ICD-11: MG24.Y] [6]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.M511I (c.1533G>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293T cells Kidney Homo sapiens (Human) CVCL_0063
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay; FACS assay
Mechanism Description Jak3 inhibitors CP-690,550 and NC1153 showed efficacy in reducing viability of Ba/F3 cells transformed with mutant forms of Jak3.
Disease Class: Hematologic Cancer [ICD-11: MG24.Y] [6]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.A573V (c.1718C>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293T cells Kidney Homo sapiens (Human) CVCL_0063
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay; FACS assay
Mechanism Description Jak3 inhibitors CP-690,550 and NC1153 showed efficacy in reducing viability of Ba/F3 cells transformed with mutant forms of Jak3.
Disease Class: Hematologic Cancer [ICD-11: MG24.Y] [7]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.H583Y (c.1747C>T)
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation JAKT/STAT signaling pathway Inhibition hsa04630
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
NIH-3T3 cells Embryo Mus musculus (Mouse) CVCL_0594
Experiment for
Molecule Alteration
Immunohistochemistry assay; Immunoblotting assay
Experiment for
Drug Resistance
CCK-8 assay
Mechanism Description A STAT3 inhibitor was active against STAT3 -mutant SNK-6 and YT cells. Novel JAK3 mutations are oncogenic and druggable in NTCL. The JAK3 or STAT3 signal was altered in NTCL, and pathway inhibition might be a therapeutic option for patients with JAK3 - or STAT3 -mutant NTCL.
Disease Class: Hematologic Cancer [ICD-11: MG24.Y] [7]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug Tofacitinib
Molecule Alteration Missense mutation
p.G589D (c.1766G>A)
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation JAKT/STAT signaling pathway Inhibition hsa04630
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
NIH-3T3 cells Embryo Mus musculus (Mouse) CVCL_0594
Experiment for
Molecule Alteration
Immunohistochemistry assay; Immunoblotting assay
Experiment for
Drug Resistance
CCK-8 assay
Mechanism Description A STAT3 inhibitor was active against STAT3 -mutant SNK-6 and YT cells. Novel JAK3 mutations are oncogenic and druggable in NTCL. The JAK3 or STAT3 signal was altered in NTCL, and pathway inhibition might be a therapeutic option for patients with JAK3 - or STAT3 -mutant NTCL.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
NS-018
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [8]
Resistant Disease Acute myeloid leukemia [ICD-11: 2A60.0]
Resistant Drug NS-018
Molecule Alteration Missense mutation
p.A572V (c.1715C>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Sf9 cells Ovary Homo sapiens (Human) CVCL_0549
Experiment for
Molecule Alteration
Colony formation assay
Experiment for
Drug Resistance
MTT assay
Mechanism Description The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the resistance of NS-018 by aberration of the drug's therapeutic target
Preclinical Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
NIBR3049
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Resistant Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Resistant Drug NIBR3049
Molecule Alteration Missense mutation
p.V674A (c.2021T>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293 cells Kidney Homo sapiens (Human) CVCL_0045
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
U4C cells Acetabulum Homo sapiens (Human) CVCL_D314
In Vivo Model Balb/c bone marrow transplantation mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Proliferation assay
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug NIBR3049
Molecule Alteration Missense mutation
p.L857P (c.2570T>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model HEK293 cells Kidney Homo sapiens (Human) CVCL_0045
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
U4C cells Acetabulum Homo sapiens (Human) CVCL_D314
In Vivo Model Balb/c bone marrow transplantation mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Proliferation assay
Investigative Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
JANEX-1
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [9]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug JANEX-1
Molecule Alteration Missense mutation
p.I87T (c.260T>C)
Experimental Note Identified from the Human Clinical Data
In Vitro Model K562 cells Blood Homo sapiens (Human) CVCL_0004
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
CCK-8 assay
Mechanism Description The missense mutation p.I87T (c.260T>C) in gene JAK3 cause the sensitivity of JANEX-1 by aberration of the drug's therapeutic target
Pyridone 6
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Lymphoma [ICD-11: 2A90- 2A85] [4]
Sensitive Disease Lymphoma [ICD-11: 2A90- 2A85]
Sensitive Drug Pyridone 6
Molecule Alteration Missense mutation
p.A572V (c.1715C>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model NK-S1 cells N.A. N.A. N.A.
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The missense mutation p.A572V (c.1715C>T) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [9]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
Sensitive Drug Pyridone 6
Molecule Alteration Missense mutation
p.Q501H (c.1503G>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model K562 cells Blood Homo sapiens (Human) CVCL_0004
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
CCK-8 assay
Mechanism Description The missense mutation p.Q501H (c.1503G>T) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [9]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
Sensitive Drug Pyridone 6
Molecule Alteration Missense mutation
p.R657Q (c.1970G>A)
Experimental Note Identified from the Human Clinical Data
In Vitro Model K562 cells Blood Homo sapiens (Human) CVCL_0004
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
CCK-8 assay
Mechanism Description The missense mutation p.R657Q (c.1970G>A) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target
Disease Class: Lymphoma [ICD-11: 2A90- 2A85] [4]
Sensitive Disease Lymphoma [ICD-11: 2A90- 2A85]
Sensitive Drug Pyridone 6
Molecule Alteration Missense mutation
p.A573V (c.1718C>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model NK-S1 cells N.A. N.A. N.A.
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The missense mutation p.A573V (c.1718C>T) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target
Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [9]
Sensitive Disease Acute myeloid leukemia [ICD-11: 2A60.0]
Sensitive Drug Pyridone 6
Molecule Alteration Missense mutation
p.I87T (c.260T>C)
Experimental Note Identified from the Human Clinical Data
In Vitro Model K562 cells Blood Homo sapiens (Human) CVCL_0004
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
CCK-8 assay
Mechanism Description The missense mutation p.I87T (c.260T>C) in gene JAK3 cause the sensitivity of JAK inhibitors by aberration of the drug's therapeutic target
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.61E-65; Fold-change: -2.32E-01; Z-score: -1.14E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.83E-01; Fold-change: -1.41E-01; Z-score: -5.37E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.71E-08; Fold-change: -6.06E-01; Z-score: -3.92E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.66E-03; Fold-change: -2.26E-01; Z-score: -9.71E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Acute myeloid leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Bone marrow
The Specified Disease Acute myeloid leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.43E-05; Fold-change: 7.14E-02; Z-score: 3.37E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Tonsil tissue
The Specified Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.40E-02; Fold-change: -2.14E-01; Z-score: -6.31E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 PIWI-interacting RNA 39980 promotes tumor progression and reduces drug sensitivity in neuroblastoma cells. J Cell Physiol. 2020 Mar;235(3):2286-2299. doi: 10.1002/jcp.29136. Epub 2019 Sep 3.
Ref 2 Distinct Acute Lymphoblastic Leukemia (ALL)-associated Janus Kinase 3 (JAK3) Mutants Exhibit Different Cytokine-Receptor Requirements and JAK Inhibitor SpecificitiesJ Biol Chem. 2015 Nov 27;290(48):29022-34. doi: 10.1074/jbc.M115.670224. Epub 2015 Oct 7.
Ref 3 FERM domain mutations induce gain of function in JAK3 in adult T-cell leukemia/lymphomaBlood. 2011 Oct 6;118(14):3911-21. doi: 10.1182/blood-2010-12-319467. Epub 2011 Aug 5.
Ref 4 Janus kinase 3-activating mutations identified in natural killer/T-cell lymphomaCancer Discov. 2012 Jul;2(7):591-7. doi: 10.1158/2159-8290.CD-12-0028. Epub 2012 Jun 15.
Ref 5 Identification of mutant alleles of JAK3 in pediatric patients with acute lymphoblastic leukemiaLeuk Lymphoma. 2015 May;56(5):1502-6. doi: 10.3109/10428194.2014.957204. Epub 2015 Jan 21.
Ref 6 Transforming Mutations of Jak3 (A573V and M511I) Show Differential Sensitivity to Selective Jak3 InhibitorsClin Cancer Drugs. 2016;3(2):131-137. doi: 10.2174/2212697X03666160610085943.
Ref 7 Novel JAK3-Activating Mutations in Extranodal NK/T-Cell Lymphoma, Nasal TypeAm J Pathol. 2017 May;187(5):980-986. doi: 10.1016/j.ajpath.2017.01.004. Epub 2017 Mar 9.
Ref 8 Efficacy of NS-018, a potent and selective JAK2/Src inhibitor, in primary cells and mouse models of myeloproliferative neoplasmsBlood Cancer J. 2011 Jul;1(7):e29. doi: 10.1038/bcj.2011.29. Epub 2011 Jul 22.
Ref 9 Functional analysis of JAK3 mutations in transient myeloproliferative disorder and acute megakaryoblastic leukaemia accompanying Down syndromeBr J Haematol. 2008 May;141(5):681-8. doi: 10.1111/j.1365-2141.2008.07081.x. Epub 2008 Apr 7.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.