Molecule Information
General Information of the Molecule (ID: Mol00281)
Name |
Cyclin-G1 (CCNG1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Cyclin-G; CCNG; CYCG1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
CCNG1
|
||||
Gene ID | |||||
Location |
chr5:163437569-163446151[+]
|
||||
Sequence |
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP Click to Show/Hide
|
||||
Function |
May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation (By similarity).
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Liver cancer | [1] | |||
Sensitive Disease | Liver cancer [ICD-11: 2C12.6] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU-739 cells | Liver | Homo sapiens (Human) | CVCL_5088 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Kidney cancer | [1] | |||
Sensitive Disease | Kidney cancer [ICD-11: 2C90.1] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | 769-P cells | Kidney | Homo sapiens (Human) | CVCL_1050 |
786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Liver cancer | [1] | |||
Sensitive Disease | Liver cancer [ICD-11: 2C12.6] | |||
Sensitive Drug | Doxorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU-739 cells | Liver | Homo sapiens (Human) | CVCL_5088 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Kidney cancer | [1] | |||
Sensitive Disease | Kidney cancer [ICD-11: 2C90.1] | |||
Sensitive Drug | Doxorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | 769-P cells | Kidney | Homo sapiens (Human) | CVCL_1050 |
786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Hepatocellular cancer | [2] | |||
Sensitive Disease | Hepatocellular cancer [ICD-11: 2C12.4] | |||
Sensitive Drug | Doxorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
Cell proliferation | Inhibition | hsa05200 | ||
p53 signaling pathway | Activation | hsa04115 | ||
In Vitro Model | Huh-7 cells | Liver | Homo sapiens (Human) | CVCL_0336 |
HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Annexin V/propidium iodide detection kit | |||
Mechanism Description | miR-122 enforced expression, as well as cyclin G1 silencing, leads to increased p53 protein stability and transcriptional activity and reduced invasion capability of HCC-derived cell lines, miR-122, through down-regulation of cyclin G1, can trigger apoptosis and increase sensitivity of HCC-derived cells to doxorubicin. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Liver cancer | [1] | |||
Sensitive Disease | Liver cancer [ICD-11: 2C12.6] | |||
Sensitive Drug | Epirubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU-739 cells | Liver | Homo sapiens (Human) | CVCL_5088 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Kidney cancer | [1] | |||
Sensitive Disease | Kidney cancer [ICD-11: 2C90.1] | |||
Sensitive Drug | Epirubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | 769-P cells | Kidney | Homo sapiens (Human) | CVCL_1050 |
786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Liver cancer | [1] | |||
Sensitive Disease | Liver cancer [ICD-11: 2C12.6] | |||
Sensitive Drug | Etoposide | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU-739 cells | Liver | Homo sapiens (Human) | CVCL_5088 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Kidney cancer | [1] | |||
Sensitive Disease | Kidney cancer [ICD-11: 2C90.1] | |||
Sensitive Drug | Etoposide | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | 769-P cells | Kidney | Homo sapiens (Human) | CVCL_1050 |
786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Liver cancer | [1] | |||
Sensitive Disease | Liver cancer [ICD-11: 2C12.6] | |||
Sensitive Drug | Gefitinib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU-739 cells | Liver | Homo sapiens (Human) | CVCL_5088 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Kidney cancer | [1] | |||
Sensitive Disease | Kidney cancer [ICD-11: 2C90.1] | |||
Sensitive Drug | Gefitinib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | 769-P cells | Kidney | Homo sapiens (Human) | CVCL_1050 |
786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Liver cancer | [1] | |||
Sensitive Disease | Liver cancer [ICD-11: 2C12.6] | |||
Sensitive Drug | Sorafenib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU-739 cells | Liver | Homo sapiens (Human) | CVCL_5088 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. | |||
Disease Class: Kidney cancer | [1] | |||
Sensitive Disease | Kidney cancer [ICD-11: 2C90.1] | |||
Sensitive Drug | Sorafenib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
miR27b/CCNG1/p53 signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | 769-P cells | Kidney | Homo sapiens (Human) | CVCL_1050 |
786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo luminescent cell viability assay | |||
Mechanism Description | miR-27b synergizes with anticancer drugs througth enhancing anticancer drug-induced cell death which due to p53 activation and CYP1B1 suppression. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Liver | |
The Specified Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.59E-02; Fold-change: 1.87E-01; Z-score: 3.07E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.38E-11; Fold-change: 4.09E-01; Z-score: 9.99E-01 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 4.15E-01; Fold-change: 1.66E-01; Z-score: 3.87E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Kidney | |
The Specified Disease | Kidney cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.99E-02; Fold-change: 3.15E-01; Z-score: 6.11E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.35E-04; Fold-change: 2.66E-01; Z-score: 6.32E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.