General Information of the Molecule (ID: Mol00169)
Name
Transcription factor SOX-2 (SOX2) ,Homo sapiens
Molecule Type
Protein
Gene Name
SOX2
Gene ID
6657
Location
chr3:181711925-181714436[+]
Sequence
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMA
QENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM
KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGY
PQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM
    Click to Show/Hide
3D-structure
PDB ID
6WX8
Classification
Nuclear protein
Method
X-ray diffraction
Resolution
2.30  Å
Function
Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Binds to the proximal enhancer region of NANOG. Critical for early embryogenesis and for embryonic stem cell pluripotency. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. May function as a switch in neuronal development.
    Click to Show/Hide
Uniprot ID
SOX2_HUMAN
Ensembl ID
ENSG00000181449
HGNC ID
HGNC:11195
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  RTDM: Regulation by the Disease Microenvironment
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Sarcoma [ICD-11: 2C35.0] [1]
Resistant Disease Sarcoma [ICD-11: 2C35.0]
Resistant Drug Cisplatin
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Sarcoma [ICD-11: 2C35]
The Specified Disease Sarcoma
The Studied Tissue Muscle tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 7.02E-14
Fold-change: 8.51E-02
Z-score: 7.66E+00
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model SW-872 cells Skin Homo sapiens (Human) CVCL_1730
SW-1353 cells Brain Homo sapiens (Human) CVCL_0543
TE-671 cells Peripheral blood Homo sapiens (Human) CVCL_1756
SW-684 cells Skin Homo sapiens (Human) CVCL_1726
SW-982 cells Testicular Homo sapiens (Human) CVCL_1734
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description By investigating of important regulators of stem cell biology, real-time RT-PCR data showed an increased expression of c-Myc, beta-catenin, and SOX-2 in the ALDH1high population and a significant higher level of ABCG2. Statistical analysis of data demonstrated that ALDH1high cells of SW-982 and SW-1353 showed higher resistance to commonly used chemotherapeutic agents like doxorubicin, epirubicin, and cisplatin than ALDH1low cells. This study demonstrates that in different sarcoma cell lines, high ALDH1 activity can be used to identify a subpopulation of cells characterized by a significantly higher proliferation rate, increased colony forming, increased expression of ABC transporter genes and stemness markers compared to control cells. In addition, enhanced drug resistance was demonstrated.
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Bladder urothelial carcinoma [ICD-11: 2C94.2] [2]
Resistant Disease Bladder urothelial carcinoma [ICD-11: 2C94.2]
Resistant Drug Cisplatin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model 5637 cells Bladder Homo sapiens (Human) CVCL_0126
J82 cells Bladder Homo sapiens (Human) CVCL_0359
T24 cells Bladder Homo sapiens (Human) CVCL_0554
BFTC 909 cells Kidney Homo sapiens (Human) CVCL_1084
BFTC 905 cells Urinary bladder Homo sapiens (Human) CVCL_1083
HT-1376 cells Urinary bladder Homo sapiens (Human) CVCL_1292
SCaBER cells Urinary bladder Homo sapiens (Human) CVCL_3599
RT-4 cells Urinary bladder Homo sapiens (Human) CVCL_0036
UM-UC3 cells Urinary bladder Homo sapiens (Human) CVCL_1783
In Vivo Model Athymic (nu+/nu+) mouse xenograft model; NOD/SCID/IL2Rgamma -/- mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blotting assay
Mechanism Description Chemotherapy-induced COX2 and YAP1 signaling may promote CSC expansion via SOX2 overexpression and subsequent chemotherapy resistance.The YAP1-SOX2 axis, via re-activated PI3K/AKT signaling, may also be relevant to an acquired resistance to the EGFR inhibitor, as demonstrated by our findings that the resistant tumors again became sensitive to the EGFR inhibitor in combination with the YAP1 inhibitor.
Gemcitabine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Bladder urothelial carcinoma [ICD-11: 2C94.2] [2]
Resistant Disease Bladder urothelial carcinoma [ICD-11: 2C94.2]
Resistant Drug Gemcitabine
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Bladder cancer [ICD-11: 2C94]
The Specified Disease Bladder cancer
The Studied Tissue Bladder tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 5.57E-02
Fold-change: 6.55E-02
Z-score: 2.25E+00
Experimental Note Identified from the Human Clinical Data
In Vitro Model 5637 cells Bladder Homo sapiens (Human) CVCL_0126
J82 cells Bladder Homo sapiens (Human) CVCL_0359
T24 cells Bladder Homo sapiens (Human) CVCL_0554
BFTC 909 cells Kidney Homo sapiens (Human) CVCL_1084
BFTC 905 cells Urinary bladder Homo sapiens (Human) CVCL_1083
HT-1376 cells Urinary bladder Homo sapiens (Human) CVCL_1292
SCaBER cells Urinary bladder Homo sapiens (Human) CVCL_3599
RT-4 cells Urinary bladder Homo sapiens (Human) CVCL_0036
UM-UC3 cells Urinary bladder Homo sapiens (Human) CVCL_1783
In Vivo Model Athymic (nu+/nu+) mouse xenograft model; NOD/SCID/IL2Rgamma -/- mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blotting assay
Mechanism Description Chemotherapy-induced COX2 and YAP1 signaling may promote CSC expansion via SOX2 overexpression and subsequent chemotherapy resistance.The YAP1-SOX2 axis, via re-activated PI3K/AKT signaling, may also be relevant to an acquired resistance to the EGFR inhibitor, as demonstrated by our findings that the resistant tumors again became sensitive to the EGFR inhibitor in combination with the YAP1 inhibitor.
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Pancreatic cancer [ICD-11: 2C10.3] [7]
Resistant Disease Pancreatic cancer [ICD-11: 2C10.3]
Resistant Drug Gemcitabine
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
Cell proliferation Activation hsa05200
In Vitro Model AsPC-1 cells Pancreas Homo sapiens (Human) CVCL_0152
CFPAC1 cells Pancreas Homo sapiens (Human) CVCL_1119
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay; Flow cytometry assay
Mechanism Description MALAT-1 could increase the proportion of pancreatic CSCs, maintain self-renewing capacity, decrease the chemosensitivity to anticancer drugs, and accelerate tumor angiogenesis in vitro, and promote tumorigenicity of pancreatic cancer cells in vivo. The underlying mechanisms may involve in increased expression of self-renewal related factors Sox2.
Paclitaxel
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [3]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Paclitaxel
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Breast cancer [ICD-11: 2C60]
The Specified Disease Breast cancer
The Studied Tissue Breast tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.42E-05
Fold-change: 2.55E-02
Z-score: 4.37E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
Cell viability Activation hsa05200
In Vitro Model MCF-7 cells Breast Homo sapiens (Human) CVCL_0031
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay; Flow cytometry assay
Mechanism Description Down-regulation of miR 200c 3p contributes to the resistance of breast cancer cells to paclitaxel by targeting SOX2.
Temozolomide
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Glioblastoma [ICD-11: 2A00.02] [4]
Sensitive Disease Glioblastoma [ICD-11: 2A00.02]
Sensitive Drug Temozolomide
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Neuroectodermal tumor
The Studied Tissue Brainstem tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 7.12E-04
Fold-change: -1.08E-01
Z-score: -3.80E+00
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
Cell apoptosis Inhibition hsa04210
Wnt/Beta-catenin signaling pathway Activation hsa04310
In Vitro Model U251 cells Brain Homo sapiens (Human) CVCL_0021
U87 cells Brain Homo sapiens (Human) CVCL_0022
Experiment for
Molecule Alteration
Western blot analysis; RT-qPCR
Experiment for
Drug Resistance
CCK8 assay; Colony formation assay; Flow cytometry assay
Mechanism Description miR-126-3p sensitizes glioblastoma cells to temozolomide by inactivating Wnt/beta-catenin signaling via targeting SOX2.
Doxorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Sarcoma [ICD-11: 2C35.0] [1]
Resistant Disease Sarcoma [ICD-11: 2C35.0]
Resistant Drug Doxorubicin
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model SW-872 cells Skin Homo sapiens (Human) CVCL_1730
SW-1353 cells Brain Homo sapiens (Human) CVCL_0543
TE-671 cells Peripheral blood Homo sapiens (Human) CVCL_1756
SW-684 cells Skin Homo sapiens (Human) CVCL_1726
SW-982 cells Testicular Homo sapiens (Human) CVCL_1734
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description By investigating of important regulators of stem cell biology, real-time RT-PCR data showed an increased expression of c-Myc, beta-catenin, and SOX-2 in the ALDH1high population and a significant higher level of ABCG2. Statistical analysis of data demonstrated that ALDH1high cells of SW-982 and SW-1353 showed higher resistance to commonly used chemotherapeutic agents like doxorubicin, epirubicin, and cisplatin than ALDH1low cells. This study demonstrates that in different sarcoma cell lines, high ALDH1 activity can be used to identify a subpopulation of cells characterized by a significantly higher proliferation rate, increased colony forming, increased expression of ABC transporter genes and stemness markers compared to control cells. In addition, enhanced drug resistance was demonstrated.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [5]
Sensitive Disease Breast cancer [ICD-11: 2C60.3]
Sensitive Drug Doxorubicin
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
Cell colony Inhibition hsa05200
Cell invasion Inhibition hsa05200
Cell migration Inhibition hsa04670
Cell viability Inhibition hsa05200
In Vitro Model MCF-7 cells Breast Homo sapiens (Human) CVCL_0031
MDA-MB-231 cells Breast Homo sapiens (Human) CVCL_0062
In Vivo Model Nude mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis; RIP assay; Luciferase reporter assay
Experiment for
Drug Resistance
CCK8; Colony formation assay; wound healing; Transwell invasion; Flow cytometry assay
Mechanism Description miR-129-5p suppresses Adriamycin resistance in breast cancer by directly targeting SOX2.
Epirubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Sarcoma [ICD-11: 2C35.0] [1]
Resistant Disease Sarcoma [ICD-11: 2C35.0]
Resistant Drug Epirubicin
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model SW-872 cells Skin Homo sapiens (Human) CVCL_1730
SW-1353 cells Brain Homo sapiens (Human) CVCL_0543
TE-671 cells Peripheral blood Homo sapiens (Human) CVCL_1756
SW-684 cells Skin Homo sapiens (Human) CVCL_1726
SW-982 cells Testicular Homo sapiens (Human) CVCL_1734
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description By investigating of important regulators of stem cell biology, real-time RT-PCR data showed an increased expression of c-Myc, beta-catenin, and SOX-2 in the ALDH1high population and a significant higher level of ABCG2. Statistical analysis of data demonstrated that ALDH1high cells of SW-982 and SW-1353 showed higher resistance to commonly used chemotherapeutic agents like doxorubicin, epirubicin, and cisplatin than ALDH1low cells. This study demonstrates that in different sarcoma cell lines, high ALDH1 activity can be used to identify a subpopulation of cells characterized by a significantly higher proliferation rate, increased colony forming, increased expression of ABC transporter genes and stemness markers compared to control cells. In addition, enhanced drug resistance was demonstrated.
Fluorouracil
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Colorectal cancer [ICD-11: 2B91.1] [6]
Resistant Disease Colorectal cancer [ICD-11: 2B91.1]
Resistant Drug Fluorouracil
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell proliferation Activation hsa05200
In Vitro Model SW480 cells Colon Homo sapiens (Human) CVCL_0546
SW620 cells Colon Homo sapiens (Human) CVCL_0547
HCT116 cells Colon Homo sapiens (Human) CVCL_0291
HT-29 cells Colon Homo sapiens (Human) CVCL_0320
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description miR-450b-5p inhibited stemness and development of chemoresistance to 5-FU by targeting SOX2 in CRC cells.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.56E-14; Fold-change: 4.49E-01; Z-score: 6.09E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.24E-01; Fold-change: 1.16E+00; Z-score: 1.23E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.52E-07; Fold-change: 9.05E-01; Z-score: 2.47E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.12E-04; Fold-change: -1.32E-01; Z-score: -3.78E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.61E-02; Fold-change: -2.38E-01; Z-score: -7.26E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.32E-03; Fold-change: -2.59E-01; Z-score: -7.01E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Muscle
The Specified Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.02E-14; Fold-change: 1.04E-02; Z-score: 5.22E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.35E-02; Fold-change: -1.10E-01; Z-score: -1.18E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.42E-05; Fold-change: 1.01E-02; Z-score: 4.44E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.18E-02; Fold-change: -5.68E-02; Z-score: -2.36E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.57E-02; Fold-change: 2.29E-01; Z-score: 6.80E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Aldehyde dehydrogenase 1, a potential marker for cancer stem cells in human sarcoma .PLoS One. 2012;7(8):e43664. doi: 10.1371/journal.pone.0043664. Epub 2012 Aug 23. 10.1371/journal.pone.0043664
Ref 2 YAP1 and COX2 Coordinately Regulate Urothelial Cancer Stem-like Cells .Cancer Res. 2018 Jan 1;78(1):168-181. doi: 10.1158/0008-5472.CAN-17-0836. Epub 2017 Nov 27. 10.1158/0008-5472.CAN-17-0836
Ref 3 Downregulation of miR 200c 3p contributes to the resistance of breast cancer cells to paclitaxel by targeting SOX2. Oncol Rep. 2018 Dec;40(6):3821-3829. doi: 10.3892/or.2018.6735. Epub 2018 Sep 26.
Ref 4 miR-126-3p sensitizes glioblastoma cells to temozolomide by inactivating Wnt/Beta-catenin signaling via targeting SOX2. Life Sci. 2019 Jun 1;226:98-106. doi: 10.1016/j.lfs.2019.04.023. Epub 2019 Apr 10.
Ref 5 microRNA-129-5p suppresses Adriamycin resistance in breast cancer by targeting SOX2. Arch Biochem Biophys. 2018 Aug 1;651:52-60. doi: 10.1016/j.abb.2018.05.018. Epub 2018 May 23.
Ref 6 miR-450b-5p Suppresses Stemness and the Development of Chemoresistance by Targeting SOX2 in Colorectal Cancer. DNA Cell Biol. 2016 May;35(5):249-56. doi: 10.1089/dna.2015.3120. Epub 2016 Feb 4.
Ref 7 Long noncoding RNA MALAT-1 enhances stem cell-like phenotypes in pancreatic cancer cells. Int J Mol Sci. 2015 Mar 24;16(4):6677-93. doi: 10.3390/ijms16046677.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.