Molecule Information

General Information of the Molecule (ID: Mol01889)

• Name: Potassium inwardly rectifying channel subfamily J member 10 (KCNJ10) ,Homo sapiens
• Synonyms: KCNJ10
• Molecule Type: Protein
• Gene Name: KCNJ10
• Gene ID: 3766
• Location: chr1:159,998,651-160,070,160[-]
• Sequence:
  MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
  DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
  FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
  FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
  DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
  LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
  LREQAEKEGSALSVRISNV
• Function: May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
• Uniprot ID: KCJ10_HUMAN
• Ensembl ID: ENSG00000177807
• HGNC ID: HGNC:6256

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 7 drug(s) in total

Carbamazepine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Carbamazepine
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Lamotrigine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Lamotrigine
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Levetiracetam

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Levetiracetam
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Oxcarbazepine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Oxcarbazepine
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Phenobarbital

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Phenobarbital
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Phenobarbital
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Topiramate

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Topiramate
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

Valproic acid

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Genetic generalized epilepsies [1]

• Sensitive Disease: Genetic generalized epilepsies [ICD-11: 8A61.0]
• Sensitive Drug: Valproic acid
• Molecule Alteration: SNP; rs12402969 C+ Genotypes CC+CT
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Genotyping assay
• Mechanism Description: By analyzing the association between KCNJ10 polymorphisms and anti-epileptic drug efficacy of GGEs we found the frequency of rs12402969 C allele and CC+CT genotypes were higher in GGEs drug responsive patients than that in drug resistant patients

References

• Ref 1: Common variants of KCNJ10 are associated with susceptibility and anti-epileptic drug resistance in Chinese genetic generalized epilepsies .PLoS One. 2015 Apr 13;10(4):e0124896. doi: 10.1371/journal.pone.0124896. eCollection 2015. 10.1371/journal.pone.0124896