Molecule Information

General Information of the Molecule (ID: Mol01185)

• Name: 23S ribosomal RNA methyltransferase Erm34 (ERM34) ,Bacillus clausii
• Molecule Type: Protein
• Gene Name: Erm(34)
• Sequence:
  MTKKMNKYNGKKLSRGEPPNFSGQHFMHNKRLLKEIVDKADVSVRDTVLELGAGKGALTT
  ILSERADRVLAVEYDQKCIEALQWKLVGSKNVSILHQDIMKVALPTEPFVVVSNIPYSIT
  TAIMKMLLNNPKNKLQRGAIVMEKGAAKRFTSVSPKDAYVMAWHMWFDIHYERGISRSSF
  SPPPKVDSALVRIVRKQHPLFPYKEAKAMHDFLSYALNNPRAPLDQVLRGIFTAPQAKKV
  RQAIGVKPETPVAMLHARQWAMVCDAMVRHVPKVYWPRRKR

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Alkalihalobacillus
Species: Alkalihalobacillus clausii KSM-K16

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 5 drug(s) in total

Clindamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Clindamycin
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

Erythromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Erythromycin
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

Lincomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Lincomycin
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

Spiramycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Spiramycin
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

Zithromax

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Zithromax
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

Clinical Trial Drug(s) 2 drug(s) in total

Pristinamycin I

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Pristinamycin I
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

Pristinamycin IA

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Pristinamycin IA
• Molecule Alteration: Methylation; Ribosomal methylation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacillus clausii ATCC 21536; 79880
• Experiment for Molecule Alteration: Cloning experiments and gene seqencing assay
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase.

References

• Ref 1: Characterization of a new erm-related macrolide resistance gene present in probiotic strains of Bacillus clausii. Appl Environ Microbiol. 2004 Jan;70(1):280-4. doi: 10.1128/AEM.70.1.280-284.2004.