Molecule Information

General Information of the Molecule (ID: Mol01075)
Name
rRNA adenine N-6-methyltransferase ermE (ERME) ,Saccharopolyspora erythraea
Synonyms
NMT; Erythromycin resistance protein; Macrolide-lincosamide-streptogramin B resistance protein; SACE_0733
    Click to Show/Hide
Molecule Type
Protein
Gene Name
ermE
Sequence
MSSSDEQPRPRRRNQDRQHPNQNRPVLGRTERDRNRRQFGQNFLRDRKTIARIAETAELR
PDLPVLEAGPGEGLLTRELADRARQVTSYEIDPRLAKSLREKLSGHPNIEVVNADFLTAE
PPPEPFAFVGAIPYGITSAIVDWCLEAPTIETATMVTQLEFARKRTGDYGRWSRLTVMTW
PLFEWEFVEKVDRRLFKPVPKVDSAIMRLRRRAEPLLEGAALERYESMVELCFTGVGGNI
QASLLRKYPRRRVEAALDHAGVGGGAVVAYVRPEQWLRLFERLDQKNEPRGGQPQRGRRT
GGRDHGDRRTGGQDRGDRRTGGRDHRDRQASGHGDRRSSGRNRDDGRTGEREQGDQGGRR
GPSGGGRTGGRPGRRGGPGQR
    Click to Show/Hide
Function
This protein produces a dimethylation of the adenine residue at position 2085 in 23S rRNA, resulting in reduced affinity between ribosomes and macrolide-lincosamide-streptogramin B antibiotics.
    Click to Show/Hide
Uniprot ID
ERME_SACEN
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Pseudonocardiales
Family: Pseudonocardiaceae
Genus: Saccharopolyspora
Species: Saccharopolyspora erythraea
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clarithromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Clarithromycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli AS19 562
Escherichia coli AS19-RrmA- 562
Escherichia coli DH10B 316385
Escherichia coli JC7623 562
Experiment for
Drug Resistance		 Agar dilution method assay
Mechanism Description Methylation of specific nucleotides in rRNA is one of the means by which bacteria achieve resistance to macrolides-lincosamides-streptogramin B (MLSB) and ketolide antibiotics.ErmE dimethylation confers high resistance to all the MLSB and ketolide drugs.
Clindamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Clindamycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli AS19 562
Escherichia coli AS19-RrmA- 562
Escherichia coli DH10B 316385
Escherichia coli JC7623 562
Experiment for
Drug Resistance		 Agar dilution method assay
Mechanism Description Methylation of specific nucleotides in rRNA is one of the means by which bacteria achieve resistance to macrolides-lincosamides-streptogramin B (MLSB) and ketolide antibiotics.ErmE dimethylation confers high resistance to all the MLSB and ketolide drugs.
Erythromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Erythromycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli AS19 562
Escherichia coli AS19-RrmA- 562
Escherichia coli DH10B 316385
Escherichia coli JC7623 562
Experiment for
Drug Resistance		 Agar dilution method assay
Mechanism Description Methylation of specific nucleotides in rRNA is one of the means by which bacteria achieve resistance to macrolides-lincosamides-streptogramin B (MLSB) and ketolide antibiotics.ErmE dimethylation confers high resistance to all the MLSB and ketolide drugs.
Lincomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Lincomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli AS19 562
Escherichia coli AS19-RrmA- 562
Escherichia coli DH10B 316385
Escherichia coli JC7623 562
Experiment for
Drug Resistance		 Agar dilution method assay
Mechanism Description Methylation of specific nucleotides in rRNA is one of the means by which bacteria achieve resistance to macrolides-lincosamides-streptogramin B (MLSB) and ketolide antibiotics.ErmE dimethylation confers high resistance to all the MLSB and ketolide drugs.
Telithromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Telithromycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli AS19 562
Escherichia coli AS19-RrmA- 562
Escherichia coli DH10B 316385
Escherichia coli JC7623 562
Experiment for
Drug Resistance		 Agar dilution method assay
Mechanism Description Methylation of specific nucleotides in rRNA is one of the means by which bacteria achieve resistance to macrolides-lincosamides-streptogramin B (MLSB) and ketolide antibiotics.ErmE dimethylation confers high resistance to all the MLSB and ketolide drugs.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Pristinamycin IA
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Pristinamycin IA
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli AS19 562
Escherichia coli AS19-RrmA- 562
Escherichia coli DH10B 316385
Escherichia coli JC7623 562
Experiment for
Drug Resistance		 Agar dilution method assay
Mechanism Description Methylation of specific nucleotides in rRNA is one of the means by which bacteria achieve resistance to macrolides-lincosamides-streptogramin B (MLSB) and ketolide antibiotics.ErmE dimethylation confers high resistance to all the MLSB and ketolide drugs.
References
Ref 1 Activity of the ketolide telithromycin is refractory to Erm monomethylation of bacterial rRNA. Antimicrob Agents Chemother. 2002 Jun;46(6):1629-33. doi: 10.1128/AAC.46.6.1629-1633.2002.
Ref 2 Expression of the macrolide-lincosamide-streptogramin-B-resistance methylase gene, ermE, from Streptomyces erythraeus in Escherichia coli results in N6-monomethylation and N6,N6-dimethylation of ribosomal RNA. Gene. 1987;55(2-3):319-25. doi: 10.1016/0378-1119(87)90291-5.
Ref 3 Domain V of 23S rRNA contains all the structural elements necessary for recognition by the ErmE methyltransferase. J Bacteriol. 1994 Nov;176(22):6999-7004. doi: 10.1128/jb.176.22.6999-7004.1994.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.