Molecule Information
General Information of the Molecule (ID: Mol01017)
Name |
Multidrug resistance protein PmpM (PMPM)
,Pseudomonas aeruginosa
|
||||
---|---|---|---|---|---|
Synonyms |
H(+)/drug antiporter; Multidrug-efflux transporter; norM; PA1361
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
pmpM
|
||||
Gene ID | |||||
Sequence |
MNSPALPLSRGLRIRAELKELLTLAAPIMIAQLATTAMGFVDAVMAGRASPHDLAAVALG
NSIWIPMFLLMTGTLLATTAKVAQRHGAGDQPGTGPLVRQALWLALLIGPLSGAVLWWLS EPILGLMKVRPELIGPSLLYLKGIALGFPAAALYHVLRCYTNGLGRTRPSMVLGIGGLLL NIPINYALIYGHFGMPKMGGPGCGWATGSVMWFMFLGMLFWVNKASIYRASQLFSRWEWP DRATIGPLVAVGLPIGIAVFAESSIFSVIALLIGGLDENVVAGHQIALNFSALVFMIPYS LGMAVTVRVGHNLGAGLPRDARFAAGVGMAAALGYACVSASLMLLLREQIAAMYSPDPAV IAIAASLIVFSALFQFSDALQVTAAGALRGYQDTRVTMIMTLFAYWGIGLPVGYSLGLTD WFQEPTGPRGLWQGLVVGLTGAAIMLCIRLARSARRFIRQHERLQREDAEAASVLGR Click to Show/Hide
|
||||
Function |
Multidrug efflux pump that functions as an H(+)/drug antiporter. Confers resistance to benzalkonium chloride, fluoroquinolones, ethidium bromide, acriflavine and tetraphenylphosphonium chloride.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Acriflavine
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Acriflavine | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32/pSTV28 | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance. |
Benzalkonium chloride
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Benzalkonium chloride | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32/pSTV28 | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance. |
Fluoroquinolones
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Fluoroquinolones | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32/pSTV28 | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance. |
Investigative Drug(s)
2 drug(s) in total
Homidium bromide
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Homidium bromide | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32/pSTV28 | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance. |
Tetraphenylphosphonium chloride
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tetraphenylphosphonium chloride | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli kAM32/pSTV28 | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.