Molecule Information
General Information of the Molecule (ID: Mol00851)
Name |
CAM-1 carbapenemase (CAM1)
,Pseudomonas aeruginosa
|
||||
---|---|---|---|---|---|
Synonyms |
ICEPACAM-1_00375
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
blaCAM-1
|
||||
Sequence |
MKSTAIILFLLVFSLGVFGQTGDALKISQLSGDFYIFTTYQTYKDAKVSANGMYVVTDEG
VVLIDTPWDETQLQPLLNYIKEKHNKDVVMSVSTHFHEDRTNGIEFLRTKGVKTYTTKKT DELSQKKGYERAEFLLEKDTEFKIGQYKFQTYYPGEGHAPDNIVVWFPNERILYGGCFIK STEAEDIGNLSDANIDEWSNSIKNVQKKFKNPKFVIPGHDGWASTKSLKHTLKLIKKTRK K Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Cefotaxime
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Cefotaxime | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Cefoxitin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Cefoxitin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Ceftazidime
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Ceftazidime | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Doripenem
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Doripenem | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Meropenem
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Meropenem | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Imipenem
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Imipenem | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Clinical Trial Drug(s)
1 drug(s) in total
Ceftolozane sulfate
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Ceftolozane sulfate | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
Investigative Drug(s)
1 drug(s) in total
Piperacillin/Tazobactam
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Pseudomonas infection | [1] | |||
Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
Resistant Drug | Piperacillin/Tazobactam | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli TOP10 | 83333 | ||
Pseudomonas aeruginosa N17-01167 | 287 | |||
Pseudomonas aeruginosa N17-01173 | 287 | |||
Pseudomonas aeruginosa N17-02436 | 287 | |||
Pseudomonas aeruginosa N17-02437 | 287 | |||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.