Molecule Information
General Information of the Molecule (ID: Mol00820)
Name |
Beta-lactamase (BLA)
,Acidaminococcus fermentans
|
||||
---|---|---|---|---|---|
Synonyms |
FX155_06310
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aci1
|
||||
Sequence |
MKKFCFLFLIICGLMVFCLQDCQARQKLNLADLENKYNAVIGVYAVDMENGKKICYKPDT
RFSYCSTHKVFTAAELLRQKNTSDLNEIRKFSAEDILSYAPITKDHVADGMTLAEICSAS LRWSDNTAANLILQEIGGVENFKVALKNIGDKTTKPARNEPELNLFNPKDNRDTSTPRQM VKNLQVYIFGDILSDDKKKLLIDWMSDNSITDTLIKAETPQGWKVIDKSGSGDYGARNDI AVIYPPNRKPIVMAIMSRRTEKNAKSDDAMIAEAAKRIFDNLVF Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Amoxicillin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Anaerobic Bacterial infection | [1], [2] | |||
Resistant Disease | Anaerobic Bacterial infection [ICD-11: 1A00-1A09] | |||
Resistant Drug | Amoxicillin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli JM109 | 562 | |||
Acidaminococcus fermentans RYC-MR95 | 905 | |||
Acidaminococcus fermentans RYC4093 | 905 | |||
Acidaminococcus fermentans RYC4356 | 905 | |||
Escherichia coli RYC1000 | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay; broth microdilution method assay | |||
Mechanism Description | A. intestini is the first Gram-negative coccus with demonstrated resistance to beta-lactam antibiotics. The reference genome of the A. intestini strain RyC-MR95, which was isolated from a perianal abscess of a European male diabetic patient, contains the aci1 gene, which encodes the ACI-1 class A beta-lactamase that confers resistance to penicillins and extended-spectrum cephalosporins. |
Cefotaxime
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Anaerobic Bacterial infection | [1], [2] | |||
Resistant Disease | Anaerobic Bacterial infection [ICD-11: 1A00-1A09] | |||
Resistant Drug | Cefotaxime | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli JM109 | 562 | |||
Acidaminococcus fermentans RYC-MR95 | 905 | |||
Acidaminococcus fermentans RYC4093 | 905 | |||
Acidaminococcus fermentans RYC4356 | 905 | |||
Escherichia coli RYC1000 | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay; broth microdilution method assay | |||
Mechanism Description | A. intestini is the first Gram-negative coccus with demonstrated resistance to beta-lactam antibiotics. The reference genome of the A. intestini strain RyC-MR95, which was isolated from a perianal abscess of a European male diabetic patient, contains the aci1 gene, which encodes the ACI-1 class A beta-lactamase that confers resistance to penicillins and extended-spectrum cephalosporins. |
Ceftazidime
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Anaerobic Bacterial infection | [1], [2] | |||
Resistant Disease | Anaerobic Bacterial infection [ICD-11: 1A00-1A09] | |||
Resistant Drug | Ceftazidime | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli JM109 | 562 | |||
Acidaminococcus fermentans RYC-MR95 | 905 | |||
Acidaminococcus fermentans RYC4093 | 905 | |||
Acidaminococcus fermentans RYC4356 | 905 | |||
Escherichia coli RYC1000 | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay; broth microdilution method assay | |||
Mechanism Description | A. intestini is the first Gram-negative coccus with demonstrated resistance to beta-lactam antibiotics. The reference genome of the A. intestini strain RyC-MR95, which was isolated from a perianal abscess of a European male diabetic patient, contains the aci1 gene, which encodes the ACI-1 class A beta-lactamase that confers resistance to penicillins and extended-spectrum cephalosporins. |
Penicillin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Anaerobic bacterial infection | [1], [2] | |||
Resistant Disease | Anaerobic bacterial infection [ICD-11: 1A00-1A09] | |||
Resistant Drug | Penicillin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli JM109 | 562 | |||
Acidaminococcus fermentans RYC-MR95 | 905 | |||
Acidaminococcus fermentans RYC4093 | 905 | |||
Acidaminococcus fermentans RYC4356 | 905 | |||
Escherichia coli RYC1000 | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay; broth microdilution method assay | |||
Mechanism Description | A. intestini is the first Gram-negative coccus with demonstrated resistance to beta-lactam antibiotics. The reference genome of the A. intestini strain RyC-MR95, which was isolated from a perianal abscess of a European male diabetic patient, contains the aci1 gene, which encodes the ACI-1 class A beta-lactamase that confers resistance to penicillins and extended-spectrum cephalosporins. |
Ticarcillin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Anaerobic Bacterial infection | [1], [2] | |||
Resistant Disease | Anaerobic Bacterial infection [ICD-11: 1A00-1A09] | |||
Resistant Drug | Ticarcillin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli JM109 | 562 | |||
Acidaminococcus fermentans RYC-MR95 | 905 | |||
Acidaminococcus fermentans RYC4093 | 905 | |||
Acidaminococcus fermentans RYC4356 | 905 | |||
Escherichia coli RYC1000 | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay; broth microdilution method assay | |||
Mechanism Description | A. intestini is the first Gram-negative coccus with demonstrated resistance to beta-lactam antibiotics. The reference genome of the A. intestini strain RyC-MR95, which was isolated from a perianal abscess of a European male diabetic patient, contains the aci1 gene, which encodes the ACI-1 class A beta-lactamase that confers resistance to penicillins and extended-spectrum cephalosporins. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.