General Information of the Molecule (ID: Mol00750)
Name
16S rRNA (guanine(1405)-N(7))-methyltransferase (RMTA) ,Pseudomonas aeruginosa
Synonyms
16S rRNA m7G1405 methyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
rmtA
Sequence
MSFDDALASILSSKKYRSLCPDTVRRILDQEWGRHKSPKLAVEATRTRLHGICGAYVTPE
SLKAAAAALSVGDVQKALSLHASTKERLAELDCLYDFIFSGGVPHRVLDIACGLNPLALF
IRDITSVWACDIHQGLGDVITPFAHHQGLDFTFALQDVMCTPPTETGDLALVFKLLPLLE
REQAGAAMALLQALATPRIAVSFPTRSLGGRGKGMEANYSAWFEGALPDEFEIEDTKTIG
IELVYMIKRNK
    Click to Show/Hide
Uniprot ID
Q8GRA1_PSEAI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amikacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Amikacin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
Arbekacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Arbekacin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
Gentamicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Gentamicin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
Isepamicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Isepamicin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
Kanamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Kanamycin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
Sisomicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Sisomicin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
Tobramycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tobramycin
Molecule Alteration Expression
Intergeneric lateral gene transfer
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa AR-2 287
Experiment for
Molecule Alteration
PCR screening assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation.
References
Ref 1 Acquisition of 16S rRNA methylase gene in Pseudomonas aeruginosa. Lancet. 2003 Dec 6;362(9399):1888-93. doi: 10.1016/S0140-6736(03)14959-8.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.