Molecule Information

General Information of the Molecule (ID: Mol00737)

• Name: Multidrug export protein EmrB (EMRB) ,Salmonella enterica serovar Typhimurium
• Molecule Type: Protein
• Gene Name: emrB
• Gene ID: 947167
• Sequence:
  MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGV
  ANAISIPLTGWLAKRFGEVKLFMWSTVAFAAASWACGVSSSLNMLIFFRVVQGVVAGPLI
  PLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGIA
  VVLMTLHTLRGRETHTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVV
  AVIAISFLIVWELTDDHPIVDLSLFKSRNFTIGCLCISLAYMLYFGAIVLLPQLLQEVYG
  YTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAWTFEPGMD
  FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTM
  WTDRESLHHAQLTESVTAYNPNAQTMYDKLEGLGMTHQQASGWIAQQITNQGLIISANEI
  FWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH
• Function: Part of the tripartite efflux system EmrAB-TolC, which confers resistance to antibiotics such as CCCP, FCCP, 2,4-dinitrophenol and nalidixic acid.
• Uniprot ID: Q8ZMK8_SALTY

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica subsp. enterica serovar Typhimurium

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Nalidixic acid

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Nalidixic acid
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serovar Typhimurium ATCC 14028s; 588858
• Experiment for Molecule Alteration: Quantitative real-time PCR
• Experiment for Drug Resistance: L agar plate method assay
• Mechanism Description: Overexpression or overproduction of emrAB confers drug resistance.

Novobiocin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Novobiocin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serovar Typhimurium ATCC 14028s; 588858
• Experiment for Molecule Alteration: Quantitative real-time PCR
• Experiment for Drug Resistance: L agar plate method assay
• Mechanism Description: Overexpression or overproduction of emrAB confers drug resistance.

Clinical Trial Drug(s) 1 drug(s) in total

Rhodamine 6G

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Rhodamine 6G
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serovar Typhimurium ATCC 14028s; 588858
• Experiment for Molecule Alteration: Quantitative real-time PCR
• Experiment for Drug Resistance: L agar plate method assay
• Mechanism Description: Overexpression or overproduction of emrAB confers drug resistance.

Investigative Drug(s) 1 drug(s) in total

Sodium deoxycholate

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Sodium deoxycholate
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serovar Typhimurium ATCC 14028s; 588858
• Experiment for Molecule Alteration: Quantitative real-time PCR
• Experiment for Drug Resistance: L agar plate method assay
• Mechanism Description: Overexpression or overproduction of emrAB confers drug resistance.

References

• Ref 1: Virulence and drug resistance roles of multidrug efflux systems of Salmonella enterica serovar Typhimurium. Mol Microbiol. 2006 Jan;59(1):126-41. doi: 10.1111/j.1365-2958.2005.04940.x.