Molecule Information
General Information of the Molecule (ID: Mol00736)
Name |
Multidrug export protein EmrA (EMRA)
,Salmonella enterica serovar Typhimurium
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
emrA
|
||||
Gene ID | |||||
Sequence |
MSANAEIQTPQQPAKKKGKRKTALLLLTLLFVIIAVAYGIYWFLVLRHIEETDDAYVAGN
QVQIMAQVSGSVTKVWADNTDFVKEGDVLVTLDQTDAKQAFEKAKTALASSVRQTHQLMI NSKQLQANIDVQKTALAQAQSDLNRRVPLGNANLIGREELQHARDAVASAQAQLDVAIQQ YNANQAMILNSNLEDQPAVQQAATEVRNAWLALERTRIVSPMTGYVSRRAVQPGAQISPT TPLMAVVPATDLWVDANFKETQLANMRIGQPVTVITDIYGDDVKYTGKVVGLDMGTGSAF SLLPAQNATGNWIKVVQRLPVRVELDARQLEQHPLRIGLSTLVTVDTANRDGQVLASQVR TTPVAESNAREINLAPVNKLIDDIVQANAG Click to Show/Hide
|
||||
Function |
Part of the tripartite efflux system EmrAB-TolC, which confers resistance to antibiotics such as CCCP, FCCP, 2,4-dinitrophenol and nalidixic acid. EmrA is a drug-binding protein that provides a physical link between EmrB and TolC.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Nalidixic acid
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Salmonella enterica infection | [1] | |||
Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
Resistant Drug | Nalidixic acid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
Experiment for Drug Resistance |
L agar plate method assay | |||
Mechanism Description | Overexpression or overproduction of emrAB confers drug resistance. |
Novobiocin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Salmonella enterica infection | [1] | |||
Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
Resistant Drug | Novobiocin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
Experiment for Drug Resistance |
L agar plate method assay | |||
Mechanism Description | Overexpression or overproduction of emrAB confers drug resistance. |
Clinical Trial Drug(s)
1 drug(s) in total
Rhodamine 6G
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Salmonella enterica infection | [1] | |||
Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
Resistant Drug | Rhodamine 6G | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
Experiment for Drug Resistance |
L agar plate method assay | |||
Mechanism Description | Overexpression or overproduction of emrAB confers drug resistance. |
Investigative Drug(s)
1 drug(s) in total
Sodium deoxycholate
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Salmonella enterica infection | [1] | |||
Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
Resistant Drug | Sodium deoxycholate | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
Experiment for Drug Resistance |
L agar plate method assay | |||
Mechanism Description | Overexpression or overproduction of emrAB confers drug resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.