Molecule Information

General Information of the Molecule (ID: Mol01913)

• Name: Bromodomain containing 2 (BRD2) ,Homo sapiens
• Synonyms: BRD2; KIAA9001; RING3
• Molecule Type: Protein
• Gene Name: BRD2
• Gene ID: 6046
• Location: chr6:32,968,594-32,981,505[+]
• Sequence:
  MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
  PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
  MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM
  PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI
  PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
  SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
  LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
  MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
  SSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG
  PISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL
  GPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE
  KLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKP
  VGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS
  SDSSSSSSSSSSSDTSDSDSG
• Function: May play a role in spermatogenesis or folliculogenesis (By similarity). Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.
• Uniprot ID: BRD2_HUMAN
• Ensembl ID: ENSG00000204256
• HGNC ID: HGNC:1103

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Doxorubicin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Lymphoblastic lymphoma [1]

• Resistant Disease: Lymphoblastic lymphoma [ICD-11: 2A70.0]
• Resistant Drug: Doxorubicin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: RasGRP1/Ras/ERK signaling pathway; Activation; hsa04010
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• In Vitro Model: Jurkat cells; Pleural effusion; Homo sapiens (Human); CVCL_0065
• In Vitro Model: SUP-T1 cells; Pleural effusion; Homo sapiens (Human); CVCL_1714
• In Vitro Model: MEK-293 cells; Blood vessel; Homo sapiens (Human); N.A.
• In Vivo Model: BALB/C-nu/nu athymic nude mice model; Mus musculus
• Experiment for Molecule Alteration: sqRT-PCR; Western blotting analysis
• Experiment for Drug Resistance: MTT assay; Flow cytometry assay
• Mechanism Description: The expression of BRD2 was upregulated in drug-resistant adult T-LBL samples. Functional studies of BRD2 further demonstrated the critical role of BRD2. BRD2 induces drug resistance of T-LBL by activating the MEK/ERK/c-Myc signaling pathway.

Disease Class: Lymphoblastic lymphoma [1]

• Resistant Disease: Lymphoblastic lymphoma [ICD-11: 2A70.0]
• Resistant Drug: Doxorubicin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: RasGRP1/Ras/ERK signaling pathway; Activation; hsa04010
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• In Vitro Model: Jurkat cells; Pleural effusion; Homo sapiens (Human); CVCL_0065
• In Vitro Model: SUP-T1 cells; Pleural effusion; Homo sapiens (Human); CVCL_1714
• In Vitro Model: MEK-293 cells; Blood vessel; Homo sapiens (Human); N.A.
• In Vivo Model: BALB/C-nu/nu athymic nude mice model; Mus musculus
• Experiment for Molecule Alteration: sqRT-PCR; Western blotting analysis
• Experiment for Drug Resistance: MTT assay; Flow cytometry assay
• Mechanism Description: The expression of BRD2 was upregulated in drug-resistant adult T-LBL samples. Functional studies of BRD2 further demonstrated the critical role of BRD2. BRD2 induces drug resistance of T-LBL by activating the MEK/ERK/c-Myc signaling pathway.

References

• Ref 1: BRD2 induces drug resistance through activation of the RasGRP1/Ras/ERK signaling pathway in adult T-cell lymphoblastic lymphoma .Cancer Commun (Lond). 2020 Jun;40(6):245-259. doi: 10.1002/cac2.12039. Epub 2020 May 27. 10.1002/cac2.12039