Molecule Information

General Information of the Molecule (ID: Mol01910)

Name	Reticulocalbin 1 (RCN1) ,Homo sapiens
Synonyms	RCN1; RCN Click to Show/Hide
Molecule Type	Protein
Gene Name	RCN1
Gene ID	5954
Location	chr11:32,091,074-32,105,722[+]
Sequence	MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH EAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNV AKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADL NGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKL TKEEILENWNMFVGSQATNYGEDLTKNHDEL Click to Show/Hide
Function	May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. Click to Show/Hide
Uniprot ID	RCN1_HUMAN
Ensembl ID	ENSG00000049449
HGNC ID	HGNC:9934
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Doxorubicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Uterine cancer				[1]
Resistant Disease	Uterine cancer [ICD-11: 2C78.0]			Disease Info
Resistant Drug	Doxorubicin			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	MES-SA cells	Uterus	Homo sapiens (Human)	CVCL_1404
Experiment for Molecule Alteration	Western blotting assay
Experiment for Drug Resistance	MTT assay
Mechanism Description	RCN1 silencing has a significant role on doxorubicin-induced apoptosis in resistant cells, MES-SA/DxR-2 uM and MES-SA/DxR-8 uM, implying RCN1 knockdown has an auxiliary effect to increase resistant cell death during doxorubicin treatment.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Uterine cancer [ICD-11: 2C78]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Endometrium
The Specified Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.30E-08; Fold-change: -5.00E-01; Z-score: -6.16E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.13E-03; Fold-change: -3.86E-01; Z-score: -1.22E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	Identification of up- and down-regulated proteins in doxorubicin-resistant uterine cancer cells: reticulocalbin-1 plays a key role in the development of doxorubicin-associated resistance .Pharmacol Res. 2014 Dec;90:1-17. doi: 10.1016/j.phrs.2014.08.007. Epub 2014 Sep 19. 10.1016/j.phrs.2014.08.007