General Information of the Molecule (ID: Mol01834)
Name
Splicing factor 3B subunit 1 (SF3B1) ,Homo sapiens
Synonyms
Splicing factor 3B subunit 1; (Pre-mRNA-splicing factor SF3b 155 kDa subunit; SF3b155; Spliceosome-associated protein 155; SAP 155
    Click to Show/Hide
Molecule Type
Protein
Gene Name
SF3B1
Gene ID
23451
Location
chr2:197,388,515-197,435,079[-]
Sequence
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK
KHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
LKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTE
RDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPI
GTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAG
YVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLM
SPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNL
AKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQA
RHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSP
DEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVEL
ANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAF
QEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRL
TPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNT
FGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPE
LNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK
VRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL
    Click to Show/Hide
3D-structure
PDB ID
7Q4O
Classification
Nuclear protein
Method
Electron microscopy
Resolution
2.10  Å
Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. Together with other U2 snRNP complex components may also play a role in the selective processing of microRNAs (miRNAs) from the long primary miRNA transcript, pri-miR-17-92. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
    Click to Show/Hide
Uniprot ID
SF3B1_HUMAN
Ensembl ID
ENSG00000115524
HGNC ID
HGNC:10768
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Preclinical Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
E7107
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Hematologic Cancer [ICD-11: MG24.Y] [1]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug E7107
Molecule Alteration Missense mutation
p.K700E (c.2098A>G)
Experimental Note Identified from the Human Clinical Data
Spliceosome inhibitors
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Spliceosome inhibitors
Molecule Alteration Missense mutation
p.K700E (c.2098A>G)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
HEC1A cells Uterus Homo sapiens (Human) CVCL_0293
Panc 0504 cells Pancreas Homo sapiens (Human) CVCL_1637
MFE296 cells Endometrium Homo sapiens (Human) CVCL_1406
HEC59 cells Endometrium Homo sapiens (Human) CVCL_2930
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
Experiment for
Drug Resistance
CellTiter-Glo assay; IC50 assay
Disease Class: Solid tumour/cancer [ICD-11: 2A00-2F9Z] [2]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Spliceosome inhibitors
Molecule Alteration Missense mutation
p.K666N (c.1998G>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
HEC1A cells Uterus Homo sapiens (Human) CVCL_0293
Panc 0504 cells Pancreas Homo sapiens (Human) CVCL_1637
MFE296 cells Endometrium Homo sapiens (Human) CVCL_1406
HEC59 cells Endometrium Homo sapiens (Human) CVCL_2930
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
Experiment for
Drug Resistance
CellTiter-Glo assay; IC50 assay
Spliceostatin A
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0] [3]
Sensitive Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Sensitive Drug Spliceostatin A
Molecule Alteration Missense mutation
p.K700E (c.2098A>G)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
HEC1A cells Uterus Homo sapiens (Human) CVCL_0293
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
Pancreatic Panc 0504 cells Pancreas Homo sapiens (Human) CVCL_1637
MFE296 cells Endometrium Homo sapiens (Human) CVCL_1406
HEC59 cells Endometrium Homo sapiens (Human) CVCL_2930
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
DSMZ cells N.A. N.A. N.A.
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
Experiment for
Molecule Alteration
qRT-PCR
Experiment for
Drug Resistance
CellTiter-Glo assay
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [3]
Sensitive Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Sensitive Drug Spliceostatin A
Molecule Alteration Missense mutation
p.K666N (c.1998G>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
HEC1A cells Uterus Homo sapiens (Human) CVCL_0293
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
Pancreatic Panc 0504 cells Pancreas Homo sapiens (Human) CVCL_1637
MFE296 cells Endometrium Homo sapiens (Human) CVCL_1406
HEC59 cells Endometrium Homo sapiens (Human) CVCL_2930
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
DSMZ cells N.A. N.A. N.A.
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
Experiment for
Molecule Alteration
qRT-PCR
Experiment for
Drug Resistance
CellTiter-Glo assay
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [3]
Sensitive Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Sensitive Drug Spliceostatin A
Molecule Alteration Missense mutation
p.K700E (c.2098A>G)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
HEC1A cells Uterus Homo sapiens (Human) CVCL_0293
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
Pancreatic Panc 0504 cells Pancreas Homo sapiens (Human) CVCL_1637
MFE296 cells Endometrium Homo sapiens (Human) CVCL_1406
HEC59 cells Endometrium Homo sapiens (Human) CVCL_2930
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
DSMZ cells N.A. N.A. N.A.
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
Experiment for
Molecule Alteration
qRT-PCR
Experiment for
Drug Resistance
CellTiter-Glo assay
Disease Class: Endometrial adenocarcinoma [ICD-11: 2C76.0] [3]
Sensitive Disease Endometrial adenocarcinoma [ICD-11: 2C76.0]
Sensitive Drug Spliceostatin A
Molecule Alteration Missense mutation
p.K666N (c.1998G>C)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
HEC1A cells Uterus Homo sapiens (Human) CVCL_0293
Capan-1 cells Pancreas Homo sapiens (Human) CVCL_0237
Capan-2 cells Pancreas Homo sapiens (Human) CVCL_0026
Pancreatic Panc 0504 cells Pancreas Homo sapiens (Human) CVCL_1637
MFE296 cells Endometrium Homo sapiens (Human) CVCL_1406
HEC59 cells Endometrium Homo sapiens (Human) CVCL_2930
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
DSMZ cells N.A. N.A. N.A.
ESS-1 cells Endometrium Homo sapiens (Human) CVCL_1205
Experiment for
Molecule Alteration
qRT-PCR
Experiment for
Drug Resistance
CellTiter-Glo assay
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.41E-03; Fold-change: 6.14E-01; Z-score: 1.40E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.44E-02; Fold-change: -2.37E-01; Z-score: -3.66E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.21E-02; Fold-change: -1.31E-02; Z-score: -1.76E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.92E-04; Fold-change: -5.30E-01; Z-score: -5.62E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Physiologic Expression of Sf3b1(K700E) Causes Impaired Erythropoiesis, Aberrant Splicing, and Sensitivity to Therapeutic Spliceosome ModulationCancer Cell. 2016 Sep 12;30(3):404-417. doi: 10.1016/j.ccell.2016.08.006.
Ref 2 STATISTICS/DATA TYPE - iGMDR.
Ref 3 SF3B1 mutations constitute a novel therapeutic target in breast cancerJ Pathol. 2015 Mar;235(4):571-80. doi: 10.1002/path.4483. Epub 2014 Dec 22.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.