Molecule Information
General Information of the Molecule (ID: Mol01834)
Name |
Splicing factor 3B subunit 1 (SF3B1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Splicing factor 3B subunit 1; (Pre-mRNA-splicing factor SF3b 155 kDa subunit; SF3b155; Spliceosome-associated protein 155; SAP 155
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
SF3B1
|
||||
Gene ID | |||||
Location |
chr2:197,388,515-197,435,079[-]
|
||||
Sequence |
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK KHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE LKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTE RDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPI GTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAG YVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLM SPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNL AKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQA RHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSP DEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVEL ANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAF QEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRL TPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNT FGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPE LNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK VRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL Click to Show/Hide
|
||||
Function |
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. Together with other U2 snRNP complex components may also play a role in the selective processing of microRNAs (miRNAs) from the long primary miRNA transcript, pri-miR-17-92. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Preclinical Drug(s)
3 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Hematologic Cancer | [1] | |||
Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
Sensitive Drug | E7107 | |||
Molecule Alteration | Missense mutation | p.K700E (c.2098A>G) |
||
Experimental Note | Identified from the Human Clinical Data |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Solid tumour/cancer | [2] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | Spliceosome inhibitors | |||
Molecule Alteration | Missense mutation | p.K700E (c.2098A>G) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
HEC1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
Panc 0504 cells | Pancreas | Homo sapiens (Human) | CVCL_1637 | |
MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
HEC59 cells | Endometrium | Homo sapiens (Human) | CVCL_2930 | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
Experiment for Drug Resistance |
CellTiter-Glo assay; IC50 assay | |||
Disease Class: Solid tumour/cancer | [2] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | Spliceosome inhibitors | |||
Molecule Alteration | Missense mutation | p.K666N (c.1998G>C) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
HEC1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
Panc 0504 cells | Pancreas | Homo sapiens (Human) | CVCL_1637 | |
MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
HEC59 cells | Endometrium | Homo sapiens (Human) | CVCL_2930 | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
Experiment for Drug Resistance |
CellTiter-Glo assay; IC50 assay |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pancreatic ductal adenocarcinoma | [3] | |||
Sensitive Disease | Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0] | |||
Sensitive Drug | Spliceostatin A | |||
Molecule Alteration | Missense mutation | p.K700E (c.2098A>G) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
HEC1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
Pancreatic Panc 0504 cells | Pancreas | Homo sapiens (Human) | CVCL_1637 | |
MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
HEC59 cells | Endometrium | Homo sapiens (Human) | CVCL_2930 | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
DSMZ cells | N.A. | . | N.A. | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
CellTiter-Glo assay | |||
Disease Class: Breast adenocarcinoma | [3] | |||
Sensitive Disease | Breast adenocarcinoma [ICD-11: 2C60.1] | |||
Sensitive Drug | Spliceostatin A | |||
Molecule Alteration | Missense mutation | p.K666N (c.1998G>T) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
HEC1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
Pancreatic Panc 0504 cells | Pancreas | Homo sapiens (Human) | CVCL_1637 | |
MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
HEC59 cells | Endometrium | Homo sapiens (Human) | CVCL_2930 | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
DSMZ cells | N.A. | . | N.A. | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
CellTiter-Glo assay | |||
Disease Class: Breast adenocarcinoma | [3] | |||
Sensitive Disease | Breast adenocarcinoma [ICD-11: 2C60.1] | |||
Sensitive Drug | Spliceostatin A | |||
Molecule Alteration | Missense mutation | p.K700E (c.2098A>G) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
HEC1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
Pancreatic Panc 0504 cells | Pancreas | Homo sapiens (Human) | CVCL_1637 | |
MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
HEC59 cells | Endometrium | Homo sapiens (Human) | CVCL_2930 | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
DSMZ cells | N.A. | . | N.A. | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
CellTiter-Glo assay | |||
Disease Class: Endometrial adenocarcinoma | [3] | |||
Sensitive Disease | Endometrial adenocarcinoma [ICD-11: 2C76.0] | |||
Sensitive Drug | Spliceostatin A | |||
Molecule Alteration | Missense mutation | p.K666N (c.1998G>C) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
HEC1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
Capan-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0237 | |
Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
Pancreatic Panc 0504 cells | Pancreas | Homo sapiens (Human) | CVCL_1637 | |
MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
HEC59 cells | Endometrium | Homo sapiens (Human) | CVCL_2930 | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
DSMZ cells | N.A. | . | N.A. | |
ESS-1 cells | Endometrium | Homo sapiens (Human) | CVCL_1205 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
CellTiter-Glo assay |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Pancreas | |
The Specified Disease | Pancreatic cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.41E-03; Fold-change: 6.14E-01; Z-score: 1.40E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.44E-02; Fold-change: -2.37E-01; Z-score: -3.66E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.21E-02; Fold-change: -1.31E-02; Z-score: -1.76E-02 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.92E-04; Fold-change: -5.30E-01; Z-score: -5.62E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.