Molecule Information
General Information of the Molecule (ID: Mol01058)
| Name |
Putative ABC transporter ATP-binding component (OTRC)
,Streptomyces rimosus
|
||||
|---|---|---|---|---|---|
| Synonyms |
otrC; Putative ABC transporter ATP-binding component
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
otrC
|
||||
| Sequence |
MTRKTISNGARNAVEVRGLVKHFGEVKAVDGVDLDVREGTVLGVLGPXGAAXXRGALPAH
VXGPDAGRRPWRFXTWCANRRALRRTIGXHRPVRXGRRESFSGRENLYMIGRXLDLSRKD ARARADELLERFSLTEAAGRAAAKYSGGMRRRLDLAASMIGRPAVLYLDEPTTGLDPRTR NEVWDEVRSMVRDGATVLLTTQYMEEAEQLAHELTVIDRGRVIADGKVDELKTKVGGRTL QIRPAHAAELDRMVGAIAQAGLDGIAGATADHEDGVVNVPIVSDEQLSAVVGMLGERGFT ISGHQHPSAQLXEVFLAITGQKTSEAADGGPQDGPQDQQGVQDKQYEEVPA Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21 (DE3) | 469008 | ||
| Escherichia coli | 668369 | |||
| Escherichia coli ET12567 (pUZ8002) | 562 | |||
| Streptomyces rimosus M4018 | 1927 | |||
| Streptomyces rimosus SR16 | 1927 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21 (DE3) | 469008 | ||
| Escherichia coli | 668369 | |||
| Escherichia coli ET12567 (pUZ8002) | 562 | |||
| Streptomyces rimosus M4018 | 1927 | |||
| Streptomyces rimosus SR16 | 1927 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ofloxacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21 (DE3) | 469008 | ||
| Escherichia coli | 668369 | |||
| Escherichia coli ET12567 (pUZ8002) | 562 | |||
| Streptomyces rimosus M4018 | 1927 | |||
| Streptomyces rimosus SR16 | 1927 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Oxytetracycline | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21 (DE3) | 469008 | ||
| Escherichia coli | 668369 | |||
| Escherichia coli ET12567 (pUZ8002) | 562 | |||
| Streptomyces rimosus M4018 | 1927 | |||
| Streptomyces rimosus SR16 | 1927 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Vancomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21 (DE3) | 469008 | ||
| Escherichia coli | 668369 | |||
| Escherichia coli ET12567 (pUZ8002) | 562 | |||
| Streptomyces rimosus M4018 | 1927 | |||
| Streptomyces rimosus SR16 | 1927 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
