Molecule Information
General Information of the Molecule (ID: Mol00640)
| Name |
Suppressor of cytokine signaling 3 (SOCS3)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
SOCS-3; Cytokine-inducible SH2 protein 3; CIS-3; STAT-induced STAT inhibitor 3; SSI-3; CIS3; SSI3
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SOCS3
|
||||
| Gene ID | |||||
| Location |
chr17:78356778-78360077[-]
|
||||
| Sequence |
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Click to Show/Hide
|
||||
| Function |
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity and regulates IL6 signaling. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pancreatic cancer [ICD-11: 2C10.3] | [1] | |||
| Sensitive Disease | Pancreatic cancer [ICD-11: 2C10.3] | |||
| Sensitive Drug | Gemcitabine | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Pancreatic cancer [ICD-11: 2C10] | |||
| The Specified Disease | Pancreatic cancer | |||
| The Studied Tissue | Pancreas | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.08E-01 Fold-change: 4.36E-03 Z-score: 1.17E-01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell migration | Inhibition | hsa04670 | ||
| Cell proliferation | Inhibition | hsa05200 | ||
| miR221/SOCS3 signaling pathway | Regulation | N.A. | ||
| In Vitro Model | BxPC-3 cells | Pancreas | Homo sapiens (Human) | CVCL_0186 |
| PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 | |
| Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
| AsPC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0152 | |
| SW1990 cells | Pancreas | Homo sapiens (Human) | CVCL_1723 | |
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
| Mechanism Description | SOCS3 overexpression reverses miR-221 overexpression-induced proliferation, migration, emt, chemotherapy resistance, and stem cell-like properties in panc-1 cells. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast cancer [ICD-11: 2C60.3] | [2] | |||
| Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
| MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
| ZR-75 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Trypan blue dye exclusion assay | |||
| Mechanism Description | Overexpression of SOCS3 could efficiently enhance cisplatin-mediated cell cytotoxicity in breast cancer cells. SOCS3 expression is significantly higher in miR-203 knockdown cisplatin-treated MCF-7 cells, thus cause the resistance to cisplatin. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [3] | |||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
| Sensitive Drug | Fluorouracil | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | JAKT2/STAT3 signaling pathway | Inhibition | hsa04030 | |
| In Vitro Model | SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 |
| DLD1 cells | Colon | Homo sapiens (Human) | CVCL_0248 | |
| SW620 cells | Colon | Homo sapiens (Human) | CVCL_0547 | |
| CaCo2 cells | Colon | Homo sapiens (Human) | CVCL_0025 | |
| HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |
| LOVO cells | Colon | Homo sapiens (Human) | CVCL_0399 | |
| RkO cells | Colon | Homo sapiens (Human) | CVCL_0504 | |
| HT-29 cells | Colon | Homo sapiens (Human) | CVCL_0320 | |
| SW1116 cells | Colon | Homo sapiens (Human) | CVCL_0544 | |
| COLO 205 cells | Colon | Homo sapiens (Human) | CVCL_0218 | |
| COLO 320DM cells | Colon | Homo sapiens (Human) | CVCL_0219 | |
| CW-2 cells | Colon | Homo sapiens (Human) | CVCL_1151 | |
| HCT15 cells | Colon | Homo sapiens (Human) | CVCL_0292 | |
| LS174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | |
| NCI-H716 cells | Colon | Homo sapiens (Human) | CVCL_1581 | |
| SW948 cells | Colon | Homo sapiens (Human) | CVCL_0632 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis; Luciferase reporter assay | |||
| Experiment for Drug Resistance |
Caspase-9 or -3 activity assays; Spheroid formation assay; Flow cytometric analysis; MTT assay | |||
| Mechanism Description | miR196b-5p promotes stemness and chemoresistance of CRC cells to 5-fluorouracil via targeting negative regulators SOCS1 and SOCS3 of STAT3 signaling pathway, giving rise to activation of STAT3 signaling. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Pancreas | |
| The Specified Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.08E-01; Fold-change: -1.88E-01; Z-score: -2.98E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.23E-01; Fold-change: -4.65E-03; Z-score: -7.26E-03 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Breast tissue | |
| The Specified Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.67E-04; Fold-change: -8.97E-02; Z-score: -9.65E-02 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.18E-04; Fold-change: -4.23E-01; Z-score: -4.67E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
