Molecule Information
General Information of the Molecule (ID: Mol00597)
Name |
Receptor tyrosine-protein kinase erbB-3 (ERBB3)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Proto-oncogene-like protein c-ErbB-3; Tyrosine kinase-type cell surface receptor HER3; HER3
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
ERBB3
|
||||
Gene ID | |||||
Location |
chr12:56076799-56103505[+]
|
||||
Sequence |
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD SAFDNPDYWHSRLFPKANAQRT Click to Show/Hide
|
||||
Function |
Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase. May also be activated by CSPG5. Involved in the regulation of myeloid cell differentiation.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [1] | |||
Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
Sensitive Drug | Docetaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
Cell migration | Inhibition | hsa04670 | ||
Cell proliferation | Inhibition | hsa05200 | ||
PI3K/AKT signaling pathway | Inhibition | hsa04151 | ||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
Experiment for Molecule Alteration |
Western blot analysis; Luciferase reporter assay | |||
Experiment for Drug Resistance |
Colony formation assay | |||
Mechanism Description | The reintroduction of miR-205 is shown to inhibit cell proliferation and clonogenic potential, and increase the sensitivity of MCF-7 and MDA-MB-231 cells to docetaxel. miR-205 also shows a synergistic effect with docetaxel in vivo. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [2] | |||
Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
Sensitive Drug | Gefitinib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell growth | Inhibition | hsa05200 | |
PI3K/AKT signaling pathway | Inhibition | hsa04151 | ||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 | |
HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | |
Experiment for Molecule Alteration |
Luciferase target assay | |||
Experiment for Drug Resistance |
Fluorescence-activated cell sorting assay | |||
Mechanism Description | The activation of the PI3k/Akt survival pathway, so critically important in tumorigenesis, is for the most part driven through phosphorylation of the kinase-inactive member HER3. miR-205, negatively regulating HER3, is able to inhibit breast cancer cell proliferation and improves the response to specific targeted therapies. The reintroduction of miR-205 in SkBr3 cells inhibits their clonogenic potential and increases the responsiveness to tyrosine-kinase inhibitors Gefitinib and Lapatinib, abrogating the HER3-mediated resistance and restoring a potent proapoptotic activity. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [3] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Lapatinib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell proliferation | Activation | hsa05200 | |
ERRB2/3 signaling pathway | Activation | hsa04210 | ||
In Vitro Model | ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
WST-1 proliferation assay | |||
Mechanism Description | Breast Cancer Anti-Estrogen Resistance 4 (BCAR4) Drives Proliferation of IPH-926 lobular Carcinoma Cells. Relative high BCAR4 mRNA expression was identified in IPH-926, a cell line derived from an endocrine-resistant lobular breast cancer. Moderate BCAR4 expression was evident in MDA-MB-134 and MDA-MB-453 breast cancer cells. BCAR4 protein was detected in breast cancer cells with ectopic (ZR-75-1-BCAR4) and endogenous (IPH-926, MDA-MB-453) BCAR4 mRNA expression. knockdown of BCAR4 inhibited cell proliferation. A similar effect was observed upon knockdown of ERBB2/3 and exposure to lapatinib, implying that BCAR4 acts in an ERBB2/3-dependent manner.BCAR4 encodes a functional protein, which drives proliferation of endocrine-resistant breast cancer cells. Lapatinib, a clinically approved EGFR/ERBB2 inhibitor, counteracts BCAR4-driven tumor cell growth, a clinical relevant observation. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [2] | |||
Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
Sensitive Drug | Lapatinib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell growth | Inhibition | hsa05200 | |
PI3K/AKT signaling pathway | Inhibition | hsa04151 | ||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 | |
HEK293 cells | Kidney | Homo sapiens (Human) | CVCL_0045 | |
Experiment for Molecule Alteration |
Luciferase target assay | |||
Experiment for Drug Resistance |
Fluorescence-activated cell sorting assay | |||
Mechanism Description | The activation of the PI3k/Akt survival pathway, so critically important in tumorigenesis, is for the most part driven through phosphorylation of the kinase-inactive member HER3. miR-205, negatively regulating HER3, is able to inhibit breast cancer cell proliferation and improves the response to specific targeted therapies. The reintroduction of miR-205 in SkBr3 cells inhibits their clonogenic potential and increases the responsiveness to tyrosine-kinase inhibitors Gefitinib and Lapatinib, abrogating the HER3-mediated resistance and restoring a potent proapoptotic activity. |
Preclinical Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | Anti-HER3 mAbs | |||
Molecule Alteration | Missense mutation | p.G284R (c.850G>A) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.G284R (c.850G>A) in gene ERBB3 cause the sensitivity of anti-HER3 mAbs by aberration of the drug's therapeutic target | |||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | Anti-HER3 mAbs | |||
Molecule Alteration | Missense mutation | p.P262H (c.785C>A) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.P262H (c.785C>A) in gene ERBB3 cause the sensitivity of anti-HER3 mAbs by aberration of the drug's therapeutic target |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | PI3K pathway inhibitors/MEK inhibitors | |||
Molecule Alteration | Missense mutation | p.Q809R (c.2426A>G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.Q809R (c.2426A>G) in gene ERBB3 cause the sensitivity of PI3K pathway inhibitors + MEK inhibitors by unusual activation of pro-survival pathway | |||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | PI3K pathway inhibitors/MEK inhibitors | |||
Molecule Alteration | Missense mutation | p.P262H (c.785C>A) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.P262H (c.785C>A) in gene ERBB3 cause the sensitivity of PI3K pathway inhibitors + MEK inhibitors by unusual activation of pro-survival pathway | |||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | PI3K pathway inhibitors/MEK inhibitors | |||
Molecule Alteration | Missense mutation | p.G284R (c.850G>A) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.G284R (c.850G>A) in gene ERBB3 cause the sensitivity of PI3K pathway inhibitors + MEK inhibitors by unusual activation of pro-survival pathway | |||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | PI3K pathway inhibitors/MEK inhibitors | |||
Molecule Alteration | Missense mutation | p.Q809R (c.2426A>G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.Q809R (c.2426A>G) in gene ERBB3 cause the sensitivity of PI3K pathway inhibitors + MEK inhibitors by unusual activation of pro-survival pathway | |||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | PI3K pathway inhibitors/MEK inhibitors | |||
Molecule Alteration | Missense mutation | p.P262H (c.785C>A) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.P262H (c.785C>A) in gene ERBB3 cause the sensitivity of PI3K pathway inhibitors + MEK inhibitors by unusual activation of pro-survival pathway | |||
Disease Class: Solid tumour/cancer | [4] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | PI3K pathway inhibitors/MEK inhibitors | |||
Molecule Alteration | Missense mutation | p.G284R (c.850G>A) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Mechanism Description | The missense mutation p.G284R (c.850G>A) in gene ERBB3 cause the sensitivity of PI3K pathway inhibitors + MEK inhibitors by unusual activation of pro-survival pathway |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.51E-01; Fold-change: 1.01E-01; Z-score: 1.65E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.36E-03; Fold-change: 1.66E-01; Z-score: 3.95E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.