Molecule Information
General Information of the Molecule (ID: Mol00565)
| Name |
Zinc finger protein PLAG1 (PLAG1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Pleiomorphic adenoma gene 1 protein
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
PLAG1
|
||||
| Gene ID | |||||
| Location |
chr8:56160909-56211324[-]
|
||||
| Sequence |
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER
PYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKET FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGV KEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL LKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQS SGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYL MELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQ LFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSA AFTSSLSTSTTLPRFHQAFQ Click to Show/Hide
|
||||
| Function |
Transcription factor whose activation results in up-regulation of target genes, such as IGFII, leading to uncontrolled cell proliferation: when overexpressed in cultured cells, higher proliferation rate and transformation are observed. Other target genes such as CRLF1, CRABP2, CRIP2, PIGF are strongly induced in cells with PLAG1 induction. Proto-oncogene whose ectopic expression can trigger the development of pleomorphic adenomas of the salivary gland and lipoblastomas. Overexpression is associated with up-regulation of IGFII, is frequently observed in hepatoblastoma, common primary liver tumor in childhood. Cooperates with CBFB-MYH11, a fusion gene important for myeloid leukemia.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] | [1] | |||
| Sensitive Disease | Acute myeloid leukemia [ICD-11: 2A60.0] | |||
| Sensitive Drug | TRAIL | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Acute myeloid leukemia [ICD-11: 2A60] | |||
| The Specified Disease | Acute myelocytic leukemia | |||
| The Studied Tissue | Bone marrow | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.54E-01 Fold-change: -2.99E-02 Z-score: -1.43E+00 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell proliferation | Inhibition | hsa05200 | ||
| In Vitro Model | HL60 cells | Peripheral blood | Homo sapiens (Human) | CVCL_0002 |
| K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | |
| K562/A02 cells | Blood | Homo sapiens (Human) | CVCL_0368 | |
| NB4 cells | Bone marrow | Homo sapiens (Human) | CVCL_0005 | |
| HL-60/ADR cells | Blood | Homo sapiens (Human) | CVCL_0304 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | miR-424 and miR-27a increase TRAIL sensitivity of acute myeloid leukemia by targeting PLAG1. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specified Disease | Acute myeloid leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.54E-01; Fold-change: -3.17E-01; Z-score: -8.77E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
