Molecule Information

General Information of the Molecule (ID: Mol00542)

Name	Osteopontin (OPN) ,Homo sapiens
Synonyms	Bone sialoprotein 1; Nephropontin; Secreted phosphoprotein 1; SPP-1; Urinary stone protein; Uropontin; BNSP; OPN; PSEC0156 Click to Show/Hide
Molecule Type	Protein
Gene Name	SPP1
Gene ID	6696
Location	chr4:87975667-87983532[+]
Sequence	MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNA VSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQS DESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQ YPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF RISHELDSASSEVN Click to Show/Hide
Function	Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Click to Show/Hide
Uniprot ID	OSTP_HUMAN
Ensembl ID	ENSG00000118785
HGNC ID	HGNC:11255
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Doxorubicin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Breast cancer				[1]
Sensitive Disease	Breast cancer [ICD-11: 2C60.3]			Disease Info
Sensitive Drug	Doxorubicin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell apoptosis		Activation	hsa04210
	Cell colony		Inhibition	hsa05200
	Cell invasion		Inhibition	hsa05200
	Cell viability		Inhibition	hsa05200
	p53 signaling pathway		Activation	hsa04115
In Vitro Model	MCF-7 cells	Breast	Homo sapiens (Human)	CVCL_0031
In Vivo Model	BALB/c nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The microRNA miR-181c enhances chemosensitivity and reduces chemoresistance in breast cancer cells via down-regulating osteopontin.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Breast cancer [ICD-11: 2C60]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.99E-100; Fold-change: 1.67E+00; Z-score: 2.03E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.23E-10; Fold-change: 1.03E+00; Z-score: 1.18E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	The microRNA miR-181c enhances chemosensitivity and reduces chemoresistance in breast cancer cells via down-regulating osteopontin. Int J Biol Macromol. 2019 Mar 15;125:544-556. doi: 10.1016/j.ijbiomac.2018.12.075. Epub 2018 Dec 8.