Molecule Information
General Information of the Molecule (ID: Mol00363)
Name |
Ezrin (EZR)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Cytovillin; Villin-2; p81; VIL2
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
EZR
|
||||
Gene ID | |||||
Location |
chr6:158765741-158819368[-]
|
||||
Sequence |
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL Click to Show/Hide
|
||||
Function |
Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Tongue cancer | [1] | |||
Resistant Disease | Tongue cancer [ICD-11: 2B62.0] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
Cell viability | Activation | hsa05200 | ||
Ezrin/FAKT/Src signaling pathway | Activation | hsa05205 | ||
In Vitro Model | CAL27 cells | Oral | Homo sapiens (Human) | CVCL_1107 |
SCC9 cells | Tongue | Homo sapiens (Human) | CVCL_1685 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTS assay; EdU assay; Flow cytometric analysis | |||
Mechanism Description | KCNQ1OT1 promotes TSCC cell proliferation and chemo-resistance via the regulation of miR-211-5p mediated Ezrin/Fak/Src signaling. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Diffuse large B-cell lymphoma | [2] | |||
Resistant Disease | Diffuse large B-cell lymphoma [ICD-11: 2A81.0] | |||
Resistant Drug | Cyclophosphamide | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell viability | Activation | hsa05200 | |
HDAC6/miR148b/Ezrin signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | CRL2631 cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 |
CRL2631/CHOP cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Diffuse large B-cell lymphoma | [2] | |||
Resistant Disease | Diffuse large B-cell lymphoma [ICD-11: 2A81.0] | |||
Resistant Drug | Doxorubicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell viability | Activation | hsa05200 | |
HDAC6/miR148b/Ezrin signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | CRL2631 cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 |
CRL2631/CHOP cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Diffuse large B-cell lymphoma | [2] | |||
Resistant Disease | Diffuse large B-cell lymphoma [ICD-11: 2A81.0] | |||
Resistant Drug | Prednisone | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell viability | Activation | hsa05200 | |
HDAC6/miR148b/Ezrin signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | CRL2631 cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 |
CRL2631/CHOP cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Diffuse large B-cell lymphoma | [2] | |||
Resistant Disease | Diffuse large B-cell lymphoma [ICD-11: 2A81.0] | |||
Resistant Drug | Vincristine | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell viability | Activation | hsa05200 | |
HDAC6/miR148b/Ezrin signaling pathway | Regulation | hsa05206 | ||
In Vitro Model | CRL2631 cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 |
CRL2631/CHOP cells | Bone marrow | Homo sapiens (Human) | CVCL_3611 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.