General Information of the Molecule (ID: Mol00248)
Name
Bcl-2 homologous antagonist/killer (BAK1) ,Homo sapiens
Synonyms
Apoptosis regulator BAK; Bcl-2-like protein 7; Bcl2-L-7; BAK; BCL2L7; CDN1
    Click to Show/Hide
Molecule Type
Protein
Gene Name
BAK1
Gene ID
578
Location
chr6:33572547-33580293[-]
Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
    Click to Show/Hide
3D-structure
PDB ID
2JCN
Classification
Apoptosis
Method
X-ray diffraction
Resolution
1.80  Å
Function
Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.
    Click to Show/Hide
Uniprot ID
BAK_HUMAN
Ensembl ID
ENSG00000030110
HGNC ID
HGNC:949
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  RTDM: Regulation by the Disease Microenvironment
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Doxorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Primitive neuroectodermal tumor [ICD-11: 2A00.08] [1]
Resistant Disease Primitive neuroectodermal tumor [ICD-11: 2A00.08]
Resistant Drug Doxorubicin
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Glioma
The Studied Tissue Brainstem tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 6.54E-01
Fold-change: -4.36E-02
Z-score: -5.89E-01
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
miR125b-p53/BAKT signaling pathway Activation hsa05206
In Vitro Model RD-ES cells Bones Homo sapiens (Human) CVCL_2169
Sk-ES cells Bones Homo sapiens (Human) CVCL_0627
Sk-N-MC cells Bones Homo sapiens (Human) CVCL_0530
TC-71 cells Bones Homo sapiens (Human) CVCL_2213
VH-64 cells Bones Homo sapiens (Human) CVCL_9672
WE-68 cells Bones Homo sapiens (Human) CVCL_9717
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Celltiter-glo luminescent cell viability assay
Mechanism Description miR-125b led to the development of chemoresistance by suppressing the expression of p53 and Bak, and repression of miR-125b sensitized EWS cells to apoptosis induced by treatment with various cytotoxic drugs.
Disease Class: Acute promyelocytic leukemia [ICD-11: 2A60.2] [4]
Resistant Disease Acute promyelocytic leukemia [ICD-11: 2A60.2]
Resistant Drug Doxorubicin
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
Cell proliferation Activation hsa05200
In Vitro Model HL60 cells Peripheral blood Homo sapiens (Human) CVCL_0002
K562 cells Blood Homo sapiens (Human) CVCL_0004
NB4 cells Bone marrow Homo sapiens (Human) CVCL_0005
In Vivo Model BALB/c nude mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
CCK8 assay
Mechanism Description miR-125b could promote leukemic cell proliferation and inhibit cell apoptosis by regulating the expression of tumor suppressor BCL2-antagonist/killer 1 (Bak1). transfection of a miR-125b duplex into AML cells can increase their resistance to therapeutic drugs.
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Ovarian cancer [ICD-11: 2C73.0] [3]
Resistant Disease Ovarian cancer [ICD-11: 2C73.0]
Resistant Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
In Vitro Model OV2008 cells Ovary Homo sapiens (Human) CVCL_0473
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
CCK8 assay
Mechanism Description Bak1 was a direct target of miR-125b, and down-regulation of Bak1 suppressed cisplatin-induced apoptosis and led to an increased resistance to cisplatin. miR-125b has a sig-nificantly promoting effect on chemoresistance of C13* cells and up-regulation of miR-125b expression contributes to cisplatin resistance through suppression of Bak1 expression.
Etoposide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Primitive neuroectodermal tumor [ICD-11: 2A00.08] [1]
Resistant Disease Primitive neuroectodermal tumor [ICD-11: 2A00.08]
Resistant Drug Etoposide
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
miR125b-p53/BAKT signaling pathway Activation hsa05206
In Vitro Model RD-ES cells Bones Homo sapiens (Human) CVCL_2169
Sk-ES cells Bones Homo sapiens (Human) CVCL_0627
Sk-N-MC cells Bones Homo sapiens (Human) CVCL_0530
TC-71 cells Bones Homo sapiens (Human) CVCL_2213
VH-64 cells Bones Homo sapiens (Human) CVCL_9672
WE-68 cells Bones Homo sapiens (Human) CVCL_9717
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Celltiter-glo luminescent cell viability assay
Mechanism Description miR-125b led to the development of chemoresistance by suppressing the expression of p53 and Bak, and repression of miR-125b sensitized EWS cells to apoptosis induced by treatment with various cytotoxic drugs.
Paclitaxel
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [5]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Paclitaxel
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
In Vitro Model MCF-7 cells Breast Homo sapiens (Human) CVCL_0031
SkBR3 cells Breast Homo sapiens (Human) CVCL_0033
MDA-MB-231 cells Breast Homo sapiens (Human) CVCL_0062
BT474 cells Breast Homo sapiens (Human) CVCL_0179
MDA-MB-436 cells Breast Homo sapiens (Human) CVCL_0623
MDA-MB-435 cells Breast Homo sapiens (Human) CVCL_0417
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Celltiter 96 aqueous one solution cell proliferation assay
Mechanism Description miR-125b was up-regulated in Taxol-resistant cells, causing a marked inhibition of Taxol-induced cytotoxicity and apoptosis and a subsequent increase in the resistance to Taxol in cancer cells. The pro-apoptotic Bcl-2 antagonist killer 1 (Bak1) is a direct target of miR-125b. Down-regulation of Bak1 suppressed Taxol-induced apoptosis and led to an increased resistance to Taxol.
Vincristine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Primitive neuroectodermal tumor [ICD-11: 2A00.08] [1]
Resistant Disease Primitive neuroectodermal tumor [ICD-11: 2A00.08]
Resistant Drug Vincristine
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
miR125b-p53/BAKT signaling pathway Activation hsa05206
In Vitro Model RD-ES cells Bones Homo sapiens (Human) CVCL_2169
Sk-ES cells Bones Homo sapiens (Human) CVCL_0627
Sk-N-MC cells Bones Homo sapiens (Human) CVCL_0530
TC-71 cells Bones Homo sapiens (Human) CVCL_2213
VH-64 cells Bones Homo sapiens (Human) CVCL_9672
WE-68 cells Bones Homo sapiens (Human) CVCL_9717
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Celltiter-glo luminescent cell viability assay
Mechanism Description miR-125b led to the development of chemoresistance by suppressing the expression of p53 and Bak, and repression of miR-125b sensitized EWS cells to apoptosis induced by treatment with various cytotoxic drugs.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.62E-38; Fold-change: 2.48E-01; Z-score: 9.37E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.54E-01; Fold-change: -2.48E-01; Z-score: -6.09E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.96E-01; Fold-change: 2.73E-01; Z-score: 4.14E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.91E-02; Fold-change: 1.52E-01; Z-score: 5.09E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.79E-76; Fold-change: 4.57E-01; Z-score: 1.58E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.81E-04; Fold-change: 1.48E-01; Z-score: 3.92E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Ovary
The Specified Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.14E-05; Fold-change: 8.84E-01; Z-score: 2.67E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.10E-03; Fold-change: 6.93E-01; Z-score: 1.13E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-125b develops chemoresistance in Ewing sarcoma/primitive neuroectodermal tumor. Cancer Cell Int. 2013 Mar 4;13(1):21. doi: 10.1186/1475-2867-13-21.
Ref 2 Metformin as an Enhancer for the Treatment of Chemoresistant CD34+ Acute Myeloid Leukemia Cells. Genes (Basel). 2024 May 20;15(5):648.
Ref 3 miR-125b confers resistance of ovarian cancer cells to cisplatin by targeting pro-apoptotic Bcl-2 antagonist killer 1. J Huazhong Univ Sci Technolog Med Sci. 2011 Aug;31(4):543. doi: 10.1007/s11596-011-0487-z. Epub 2011 Aug 7.
Ref 4 Upregulation of microRNA-125b contributes to leukemogenesis and increases drug resistance in pediatric acute promyelocytic leukemia. Mol Cancer. 2011 Sep 1;10:108. doi: 10.1186/1476-4598-10-108.
Ref 5 MicroRNA-125b confers the resistance of breast cancer cells to paclitaxel through suppression of pro-apoptotic Bcl-2 antagonist killer 1 (Bak1) expression. J Biol Chem. 2010 Jul 9;285(28):21496-507. doi: 10.1074/jbc.M109.083337. Epub 2010 May 11.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.