Molecule Information
General Information of the Molecule (ID: Mol00174)
| Name |
Stathmin (STMN1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; Op18; Phosphoprotein p19; pp19; Prosolin; Protein Pr22; pp17; C1orf215; LAP18; OP18
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
STMN1
|
||||
| Gene ID | |||||
| Location |
chr1:25884181-25906991[-]
|
||||
| Sequence |
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL ERLREKDKHIEEVRKNKESKDPADETEAD Click to Show/Hide
|
||||
| Function |
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gallbladder cancer | [1] | |||
| Sensitive Disease | Gallbladder cancer [ICD-11: 2C13.0] | |||
| Sensitive Drug | Docetaxel | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | GBC-SD cells | Gallbladder | Homo sapiens (Human) | CVCL_6903 |
| NOZ cells | Gallbladder | Homo sapiens (Human) | CVCL_3079 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | miR223 increases gallbladder cancer cell sensitivity to docetaxel by downregulating STMN1. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast cancer | [2] | |||
| Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
| Sensitive Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 |
| MDA-MB-468 cells | Breast | Homo sapiens (Human) | CVCL_0419 | |
| Experiment for Molecule Alteration |
qRT-PCR; Western blot analysis; Dua-luciferase reporter assay | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | miR770, a potential tumor suppressor, could specifically target and down-regulate STMN1, thus inhibit the metastasis and chemo-resistance of TNBC cells. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Breast tissue | |
| The Specified Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.39E-59; Fold-change: 4.31E-01; Z-score: 1.32E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.11E-06; Fold-change: 2.13E-01; Z-score: 6.15E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
