Molecule Information
General Information of the Molecule (ID: Mol00089)
| Name |
Homeobox protein Hox-A13 (HOXA13)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Homeobox protein Hox-1J; HOX1J
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
HOXA13
|
||||
| Gene ID | |||||
| Location |
chr7:27193503-27200091[-]
|
||||
| Sequence |
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPH
PAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAA AAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYP CARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPY HHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTN LSERQVTIWFQNRRVKEKKVINKLKTTS Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Sequence-specific, AT-rich binding transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.; FUNCTION: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.2] | [1] | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.2] | |||
| Resistant Drug | Sorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Liver cancer [ICD-11: 2C12] | |||
| The Specified Disease | Liver cancer | |||
| The Studied Tissue | Liver tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.39E-37 Fold-change: 3.53E-01 Z-score: 1.40E+01 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
| SNU449 cells | Liver | Homo sapiens (Human) | CVCL_0454 | |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
Soft Agar Colony Assay; xCELLigence assay | |||
| Mechanism Description | Stable overexpression of HOXA13 in liver cancer cell lines resulted in increased colony formation on soft agar and migration potential as well as reduced sensitivity to sorafenib in vitro. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0] | [2] | |||
| Resistant Disease | Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0] | |||
| Resistant Drug | Gemcitabine | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Pancreatic cancer [ICD-11: 2C10] | |||
| The Specified Disease | Pancreatic cancer | |||
| The Studied Tissue | Pancreas | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.13E-10 Fold-change: 2.33E-01 Z-score: 6.99E+00 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell invasion | Activation | hsa05200 | |
| Cell migration | Activation | hsa04670 | ||
| Cell proliferation | Activation | hsa05200 | ||
| HOTTIP/HOXA13 signaling pathway | Activation | hsa05202 | ||
| In Vitro Model | BxPC-3 cells | Pancreas | Homo sapiens (Human) | CVCL_0186 |
| MIA PaCa-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0428 | |
| PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 | |
| Capan-2 cells | Pancreas | Homo sapiens (Human) | CVCL_0026 | |
| SW1990 cells | Pancreas | Homo sapiens (Human) | CVCL_1723 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | The long non-coding RNA HOTTIP promotes progression and gemcitabine resistance by regulating HOXA13 in pancreatic cancer.Microarray analyses revealed that HOTTIP was one of the most significantly upregulated LncRNAs in PDAC tissues compared with pancreatic tissues.Furthermore, knockdown of HOXA13 by RNA interference (siHOXA13) revealed that HOTTIP promoted PDAC cell proliferation, invasion, and chemoresistance, at least partly through regulating HOXA13. As a crucial tumor promoter, HOTTIP promotes cell proliferation, invasion, and chemoresistance by modulating HOXA13. Therefore, the HOTTIP/HOXA13 axis is a potential therapeutic target and molecular biomarker for PDAC. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lung small cell carcinoma [ICD-11: 2C25.2] | [3] | |||
| Resistant Disease | Lung small cell carcinoma [ICD-11: 2C25.2] | |||
| Resistant Drug | Etoposide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Lung cancer [ICD-11: 2C25] | |||
| The Specified Disease | Lung cancer | |||
| The Studied Tissue | Lung tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.89E-43 Fold-change: 1.22E-01 Z-score: 1.43E+01 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | 16HBE cells | Lung | Homo sapiens (Human) | CVCL_0112 |
| H446 cells | Lung | Homo sapiens (Human) | CVCL_1562 | |
| H69 cells | Lung | Homo sapiens (Human) | CVCL_8121 | |
| H69AR cells | Lung | Homo sapiens (Human) | CVCL_3513 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | HOTTIP acts at least partly by controlling HOXA13 in SCLC poor prognostic and chemoresistance progression. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lung small cell carcinoma [ICD-11: 2C25.2] | [3] | |||
| Resistant Disease | Lung small cell carcinoma [ICD-11: 2C25.2] | |||
| Resistant Drug | Cisplatin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | 16HBE cells | Lung | Homo sapiens (Human) | CVCL_0112 |
| H446 cells | Lung | Homo sapiens (Human) | CVCL_1562 | |
| H69 cells | Lung | Homo sapiens (Human) | CVCL_8121 | |
| H69AR cells | Lung | Homo sapiens (Human) | CVCL_3513 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | HOTTIP acts at least partly by controlling HOXA13 in SCLC poor prognostic and chemoresistance progression. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lung small cell carcinoma [ICD-11: 2C25.2] | [3] | |||
| Resistant Disease | Lung small cell carcinoma [ICD-11: 2C25.2] | |||
| Resistant Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | 16HBE cells | Lung | Homo sapiens (Human) | CVCL_0112 |
| H446 cells | Lung | Homo sapiens (Human) | CVCL_1562 | |
| H69 cells | Lung | Homo sapiens (Human) | CVCL_8121 | |
| H69AR cells | Lung | Homo sapiens (Human) | CVCL_3513 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | HOTTIP acts at least partly by controlling HOXA13 in SCLC poor prognostic and chemoresistance progression. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Pancreas | |
| The Specified Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.13E-10; Fold-change: 2.33E-01; Z-score: 1.34E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.24E-10; Fold-change: 1.47E-01; Z-score: 6.01E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Liver | |
| The Specified Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.39E-37; Fold-change: 5.01E-01; Z-score: 3.19E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.11E-37; Fold-change: 5.81E-01; Z-score: 1.38E+00 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 1.06E-05; Fold-change: 7.35E-01; Z-score: 4.41E+00 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Lung | |
| The Specified Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.89E-43; Fold-change: 1.10E-01; Z-score: 8.81E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.32E-37; Fold-change: 9.47E-02; Z-score: 8.39E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
