Molecule Information
General Information of the Molecule (ID: Mol00026)
Name |
Bcl-2-binding component 3 (BBC3)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
JFY-1; p53 up-regulated modulator of apoptosis; PUMA
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
BBC3
|
||||
Gene ID | |||||
Location |
chr19:47220822-47232766[-]
|
||||
Sequence |
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLC
APTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPT QAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLP LPRGHRAPEMEPN Click to Show/Hide
|
||||
Function |
Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis. Promotes partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53, releasing the bound p53/TP53 to induce apoptosis. Regulates ER stress-induced neuronal apoptosis.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Oral squamous cell carcinoma | [1] | |||
Sensitive Disease | Oral squamous cell carcinoma [ICD-11: 2B6E.0] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell invasion | Inhibition | hsa05200 | ||
Cell proliferation | Inhibition | hsa05200 | ||
In Vitro Model | UM1 cells | Tongue | Homo sapiens (Human) | CVCL_VH00 |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
Mechanism Description | Antisense (As)-miR-222 inhibits the expression of miR-222. In contrast, PUMA was dramaticallyup-regulated. IC50 values were significantly decreased in cells treated with As-miR-222 combined with CDDP, to a greater extent than in cells treated with CDDP alone. Furthermore, As-miR-222 (+) apoptosis and inhibited the invasiveness of UM1 cells. Analysis of the above data suggested that, in UM1 cells, there might be a regulatory loop between miR-222 and PUMA, and that miR-222 inhibition increased the chemosensitivity to CDDP. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Leukemia | [2] | |||
Resistant Disease | Leukemia [ICD-11: 2B33.6] | |||
Resistant Drug | Daunorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
In Vitro Model | THP-1 cells | Blood | Homo sapiens (Human) | CVCL_0006 |
HEK293T cells | Kidney | Homo sapiens (Human) | CVCL_0063 | |
HL60 cells | Peripheral blood | Homo sapiens (Human) | CVCL_0002 | |
K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | |
Experiment for Molecule Alteration |
Luciferase reporter assay; Western blot analysis | |||
Experiment for Drug Resistance |
Luminescent cell viability assay | |||
Mechanism Description | miR125a mediated daunorubicin resistance in leukemia cell lines through the decrease of GRk2 and Puma which were proved to be direct targets of miR125a. Overexpression of miR125a induced drug resistance in HL-60, k562, and THP-1cell lines through reducing apoptosis. | |||
Disease Class: Leukemia | [3] | |||
Resistant Disease | Leukemia [ICD-11: 2B33.6] | |||
Resistant Drug | Daunorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | THP-1 cells | Blood | Homo sapiens (Human) | CVCL_0006 |
Jurkat cells | Pleural effusion | Homo sapiens (Human) | CVCL_0065 | |
K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | |
REH cells | Bone marrow | Homo sapiens (Human) | CVCL_1650 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Luminescent cell viability assay | |||
Mechanism Description | miR-125b downregulated GRk2 and PUMA, which inhibited apoptosis and induced leukemia cell resistance to DNR. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pancreatic cancer | [4] | |||
Sensitive Disease | Pancreatic cancer [ICD-11: 2C10.3] | |||
Sensitive Drug | Gemcitabine | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Slug/PUMA signaling pathway | Activation | hsa04390 | |
In Vitro Model | PANC-1 cells | Pancreas | Homo sapiens (Human) | CVCL_0480 |
Experiment for Molecule Alteration |
RT-PCR; Western blot analysis | |||
Experiment for Drug Resistance |
Flow Cytometric Analysis, MTT assay; TUNEL staining | |||
Mechanism Description | miR34 induces Slug-mediated upregulation of PUMA expression. miR34 sensitizes to gemcitabine-mediated apoptosis by PUMA upregulation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Multiple myeloma | [5] | |||
Resistant Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
Resistant Drug | Melphalan | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
In Vitro Model | NCI-H929 cells | Bone marrow | Homo sapiens (Human) | CVCL_1600 |
U266 cells | Bone marrow | Homo sapiens (Human) | CVCL_0566 | |
RPMI-8226/BTZ cells | Pancreas | Homo sapiens (Human) | CVCL_XK17 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
Mechanism Description | miR-221/222 expression inversely correlated with melphalan-sensitivity of MM cells. Inhibition of miR-221/222 overcame melphalan-resistance and triggered apoptosis of MM cells in vitro, in the presence or absence of human bone marrow stromal cells. Decreased MM cell growth induced by inhibition of miR-221/222 plus melphalan was associated with a marked upregulation of pro-apoptotic BBC3/PUMA protein, a miR-221/222 target, as well as with modulation of drug influx-efflux transporters SLC7A5/LAT1 and the ATP-binding cassette (ABC) transporter ABCC1/MRP1. Finally, in vivo treatment of SCID/NOD mice bearing human melphalan-refractory MM xenografts with systemic LNA-i-miR-221 plus melphalan overcame drug-resistance, evidenced by growth inhibition with significant antitumor effects together with modulation of PUMA and ABCC1 in tumors retrieved from treated mice. | |||
Disease Class: Multiple myeloma | [5] | |||
Resistant Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
Resistant Drug | Melphalan | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
In Vitro Model | NCI-H929 cells | Bone marrow | Homo sapiens (Human) | CVCL_1600 |
U266 cells | Bone marrow | Homo sapiens (Human) | CVCL_0566 | |
RPMI-8226/BTZ cells | Pancreas | Homo sapiens (Human) | CVCL_XK17 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
Mechanism Description | miR-221/222 expression inversely correlated with melphalan-sensitivity of MM cells. Inhibition of miR-221/222 overcame melphalan-resistance and triggered apoptosis of MM cells in vitro, in the presence or absence of human bone marrow stromal cells. Decreased MM cell growth induced by inhibition of miR-221/222 plus melphalan was associated with a marked upregulation of pro-apoptotic BBC3/PUMA protein, a miR-221/222 target, as well as with modulation of drug influx-efflux transporters SLC7A5/LAT1 and the ATP-binding cassette (ABC) transporter ABCC1/MRP1. Finally, in vivo treatment of SCID/NOD mice bearing human melphalan-refractory MM xenografts with systemic LNA-i-miR-221 plus melphalan overcame drug-resistance, evidenced by growth inhibition with significant antitumor effects together with modulation of PUMA and ABCC1 in tumors retrieved from treated mice. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Colorectal carcinoma | [6] | |||
Sensitive Disease | Colorectal carcinoma [ICD-11: 2B91.3] | |||
Sensitive Drug | Oxaliplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | P53/PUMA signaling pathway | Activation | hsa04115 | |
In Vitro Model | HT29 Cells | Colon | Homo sapiens (Human) | CVCL_A8EZ |
HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis; Luciferase reporter assay | |||
Experiment for Drug Resistance |
TUNEL and ki67 staining; Caspase-3 activity assay; MTT assay | |||
Mechanism Description | miR503-5p induces oxaliplatin resistance through the inhibition of apoptosis by reducing PUMA expression, which could direct target by miR503-5p. P53 suppresses miR503-5p expression. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Hepatocellular carcinoma | [7] | |||
Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.2] | |||
Resistant Drug | Sorafenib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | mTOR signaling pathway | Activation | hsa04150 | |
In Vitro Model | Huh-7 cells | Liver | Homo sapiens (Human) | CVCL_0336 |
HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 | |
Hep3B cells | Liver | Homo sapiens (Human) | CVCL_0326 | |
PLC/PRF/5 cells | Liver | Homo sapiens (Human) | CVCL_0485 | |
SNU182 cells | Liver | Homo sapiens (Human) | CVCL_0090 | |
SNU398 cells | Liver | Homo sapiens (Human) | CVCL_0077 | |
SNU449 cells | Liver | Homo sapiens (Human) | CVCL_0454 | |
SNU475 cells | Liver | Homo sapiens (Human) | CVCL_0497 | |
Experiment for Molecule Alteration |
Western blot analysis; Luciferase activity assay | |||
Experiment for Drug Resistance |
Cell viability assay; Caspase-3/7 activity assay; WB analysis | |||
Mechanism Description | miR494 overexpression increased sorafenib resistance via mTOR pathway activation in HCC cell lines, by targeting p27, pten, and puma. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.