Molecule Information

General Information of the Molecule (ID: Mol01122)
Name
TolC family outer membrane protein (TOLC) ,Acinetobacter baumannii
Synonyms
tolC; CSB70_4010; NCTC13305_02171; Type I secretion outer membrane; TolC family protein
    Click to Show/Hide
Molecule Type
Protein
Gene Name
tolC
Sequence
MKIKLMLVAGLWSFTSSSFALDLVETYERAKLNDPTWQANQQQFEADQLNLGLATGALLP
TVTLSGNITRNRQTVKRSNFPGVDQEGLSDALVSNTSTTKQATLSARQPLFRMDAWEGYK
QVKTSVALSEITLRLQKQDHVLNVAEAYFNVLRQQALTAAYLQEEKALLEQLNMMNAKLK
EGLVARSDVSEANAQYQNARANRIATNVQLLLAQEQLSEYIGPYQDKLAVLRSDFIFQKP
YPAQLDEWLGLAQQQNLKIQQARLQKRYAEDQRRVEKAALYPQIDAVASYGYTKQTPETL
ISTDGKFDQVGVEMNWNLFNGGRTRTSIKKASVELNKAQAQLDAAIRRANVDVKSAFMQV
DTDRAKLEARKAAMDSSALVSQASKASYNEGLKSMVDVLLAQRNAFSAKQDYLNAQYDYL
LNVLRLKAAVGQLGEKDLVELNSWLTYQ
    Click to Show/Hide
Uniprot ID
A0A1V3DAN9_ACIBA
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amikacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Amikacin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AYE WT 509173
Acinetobacter baumannii AYE detaabuO 509173
Acinetobacter baumannii AYE detaabuO Omega abuO 509173
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Disk diffusion test assay; E-strip test assay
Mechanism Description AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii.
Carbenicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Carbenicillin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AYE WT 509173
Acinetobacter baumannii AYE detaabuO 509173
Acinetobacter baumannii AYE detaabuO Omega abuO 509173
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Disk diffusion test assay; E-strip test assay
Mechanism Description AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii.
Ceftriaxone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ceftriaxone
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AYE WT 509173
Acinetobacter baumannii AYE detaabuO 509173
Acinetobacter baumannii AYE detaabuO Omega abuO 509173
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Disk diffusion test assay; E-strip test assay
Mechanism Description AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii.
Meropenem
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Meropenem
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AYE WT 509173
Acinetobacter baumannii AYE detaabuO 509173
Acinetobacter baumannii AYE detaabuO Omega abuO 509173
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Disk diffusion test assay; E-strip test assay
Mechanism Description AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii.
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Streptomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AYE WT 509173
Acinetobacter baumannii AYE detaabuO 509173
Acinetobacter baumannii AYE detaabuO Omega abuO 509173
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Disk diffusion test assay; E-strip test assay
Mechanism Description AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii.
Tigecycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Tigecycline
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AYE WT 509173
Acinetobacter baumannii AYE detaabuO 509173
Acinetobacter baumannii AYE detaabuO Omega abuO 509173
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Disk diffusion test assay; E-strip test assay
Mechanism Description AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii.
References
Ref 1 AbuO, a TolC-like outer membrane protein of Acinetobacter baumannii, is involved in antimicrobial and oxidative stress resistance. Antimicrob Agents Chemother. 2015 Feb;59(2):1236-45. doi: 10.1128/AAC.03626-14. Epub 2014 Dec 15.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.