Molecule Information

General Information of the Molecule (ID: Mol01019)
Name
Multifunctional fusion protein (LPXA) ,Acinetobacter baumannii
Synonyms
(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Beta-hydroxyacyl-ACP dehydratase; (3R)-hydroxymyristoyl-ACP dehydrase; UDP-N-acetylglucosamine acyltransferase; fabZ; lpxA; NCTC13305_00288
    Click to Show/Hide
Molecule Type
Protein
Gene Name
lpxA_2
Sequence
MTESTTPKFAIPELPMQIQTIRQYLPHRYPFLLVDRVTEVTDNSIVGYKNVSINEEFLQG
HFPEYPIMPGVLIVEALAQVSGVLGFIMNNETPKPGSLFLFAGAERVRFKKQVVAGDQLV
LKSELVMQKRGIYKYNCTASVDGIVAATAEIMISHQKNRAGMSNHDLIHSTAIIDPSAVI
ASDVQIGPYCIIGPQVTIGAGTKLHSHVVVGGFTRIGQNNEIFQFASVGEVCQDLKYKGE
ETWLEIGNNNLIREHCSLHRGTVQDNALTKIGSHNLLMVNTHIAHDCIVGDHNIFANNVG
VAGHVHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAFGINIE
GMRRKGWSKNTIQGLREAYKLIFKSGLTSVQAIEQIKSEILPSVPEAQLLIDSLEQSERG
IVR
    Click to Show/Hide
Function
Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.
    Click to Show/Hide
Uniprot ID
A0A380UNQ5_ACIBA
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Colistin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.90del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.H159D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1844 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
c.700C>T
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1845 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.G68D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1846 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.391_421del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.Q72K
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1848 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.76_78del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.364_809del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.90del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.H159D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1844 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
c.700C>T
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1845 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.G68D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1846 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.391_421del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.Q72K
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1848 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.76_78del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter meningitis [1], [2]
Resistant Disease Acinetobacter meningitis [ICD-11: 1D01.1]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.364_809del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.90del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.H159D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1844 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
c.700C>T
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1845 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.G68D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1846 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.391_421del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.Q72K
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1848 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.76_78del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.364_809del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.90del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.H159D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1844 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
c.700C>T
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1845 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.G68D
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1846 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.391_421del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Missense mutation
p.Q72K
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AL1848 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.76_78del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
Disease Class: Acinetobacter baumannii infection [1], [2]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
 Disease Info 
Resistant Drug Colistin
 Drug Info 
Molecule Alteration Frameshift mutation
c.364_809del
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii ATCC 19606 575584
Acinetobacter baumannii FADDI008 470
Experiment for
Molecule Alteration		 Whole genome sequence assay
Experiment for
Drug Resistance		 Broth microdilution method assay
Mechanism Description A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS.
References
Ref 1 Colistin resistance in Acinetobacter baumannii is mediated by complete loss of lipopolysaccharide production. Antimicrob Agents Chemother. 2010 Dec;54(12):4971-7. doi: 10.1128/AAC.00834-10. Epub 2010 Sep 20.
Ref 2 Biological cost of different mechanisms of colistin resistance and their impact on virulence in Acinetobacter baumannii. Antimicrob Agents Chemother. 2014;58(1):518-26. doi: 10.1128/AAC.01597-13. Epub 2013 Nov 4.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.