Molecule Information

General Information of the Molecule (ID: Mol01000)
Name
Melanoma antigen A 4 (MAGE4) ,Homo sapiens
Synonyms
MAGEA4; MAGEA4); mRNA
    Click to Show/Hide
Molecule Type
Protein
Gene Name
MAGEA4
Sequence
MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESA
GPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHF
LLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLV
TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVY
GEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI
AYPSLREAALLEEEEGV
    Click to Show/Hide
Uniprot ID
Q1RN33_HUMAN
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Carboplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Retinoblastoma [1]
Sensitive Disease Retinoblastoma [ICD-11: 2D02.2]
 Disease Info 
Sensitive Drug Carboplatin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
MAGE-A/p53 signaling pathway Regulation hsa04115
In Vitro Model HXO-Rb44 cells Retina Homo sapiens (Human) CVCL_D542
SO-Rb50 cells Retina Homo sapiens (Human) CVCL_D543
WERI-Rb-1 cells Retina Homo sapiens (Human) CVCL_1792
Y79 cells Retina Homo sapiens (Human) CVCL_1893
Experiment for
Molecule Alteration		 Western blot analysis; RT-qPCR
Experiment for
Drug Resistance		 Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
Mechanism Description miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).
Doxorubicin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Retinoblastoma [1]
Sensitive Disease Retinoblastoma [ICD-11: 2D02.2]
 Disease Info 
Sensitive Drug Doxorubicin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
MAGE-A/p53 signaling pathway Regulation hsa04115
In Vitro Model HXO-Rb44 cells Retina Homo sapiens (Human) CVCL_D542
SO-Rb50 cells Retina Homo sapiens (Human) CVCL_D543
WERI-Rb-1 cells Retina Homo sapiens (Human) CVCL_1792
Y79 cells Retina Homo sapiens (Human) CVCL_1893
Experiment for
Molecule Alteration		 Western blot analysis; RT-qPCR
Experiment for
Drug Resistance		 Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
Mechanism Description miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).
Etoposide
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Retinoblastoma [1]
Sensitive Disease Retinoblastoma [ICD-11: 2D02.2]
 Disease Info 
Sensitive Drug Etoposide
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
MAGE-A/p53 signaling pathway Regulation hsa04115
In Vitro Model HXO-Rb44 cells Retina Homo sapiens (Human) CVCL_D542
SO-Rb50 cells Retina Homo sapiens (Human) CVCL_D543
WERI-Rb-1 cells Retina Homo sapiens (Human) CVCL_1792
Y79 cells Retina Homo sapiens (Human) CVCL_1893
Experiment for
Molecule Alteration		 Western blot analysis; RT-qPCR
Experiment for
Drug Resistance		 Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
Mechanism Description miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).
Vincristine
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Retinoblastoma [1]
Sensitive Disease Retinoblastoma [ICD-11: 2D02.2]
 Disease Info 
Sensitive Drug Vincristine
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
MAGE-A/p53 signaling pathway Regulation hsa04115
In Vitro Model HXO-Rb44 cells Retina Homo sapiens (Human) CVCL_D542
SO-Rb50 cells Retina Homo sapiens (Human) CVCL_D543
WERI-Rb-1 cells Retina Homo sapiens (Human) CVCL_1792
Y79 cells Retina Homo sapiens (Human) CVCL_1893
Experiment for
Molecule Alteration		 Western blot analysis; RT-qPCR
Experiment for
Drug Resistance		 Freedom Evolyzer-2200 Enzyme-Linked Immunometric meter; Flow cytometry assay
Mechanism Description miR-34a may function as a tumor suppressor for RB by targeting MAGE-A and upregulating p53 expression to enhance cell apoptosis and chemosensitivity (Carboplatin; Etoposide; Adriamycin; vincristine).
References
Ref 1 miR 34a regulates the chemosensitivity of retinoblastoma cells via modulation of MAGE A/p53 signaling. Int J Oncol. 2019 Jan;54(1):177-187. doi: 10.3892/ijo.2018.4613. Epub 2018 Oct 31.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.