Molecule Information

General Information of the Molecule (ID: Mol00896)

• Name: Dihydrofolate reductase (DHFR) ,Escherichia coli
• Synonyms: dfr17; dfrA; dhfr17; dhfrA17; AKG29_00690; BON71_09100; BON81_06950; BON82_23795; BON83_00130; BON86_00200; BON87_24910; BVL39_07840; C5N07_28340; CDC27_27020; CDL36_28485; CDL37_03930; CWS33_26355; D0X26_01220; D0X26_28460; E2646_24960; E5P27_23655; E5P44_22195; E5P45_23940; E5P46_21200; E5P47_22545; E5P49_22525; E5P50_23750; EAN77_29860; EAN77_31025; EHH55_26460; EIZ93_24725; ELT16_24660; ELT17_24370; ELT17_26535; ELT20_22050; ELT24_24270; ELT30_23905; ELT31_25005; ELT31_26075; ELT32_25290; ELT33_25145; ELT34_24315; ELT35_24175; ELT39_24930; ELT50_25070; ELT51_25310; ELT52_24415; ELT55_25070; ELT59_24930; ELT61_25350; ELT63_25360; ELT72_24990; ELU07_24215; ELU88_24760; ELU89_23625; ELU91_25280; ELU94_23205; ELU98_22920; ELV00_24845; ELV02_25915; ELV03_25830; ELV04_25175; ELV07_26135; ELV08_25745; ELV09_26230; ELV12_23125; ELV13_25085; ELV15_23990; ELV20_24985; ELV22_23800; ELV22_25890; ELV24_24250; ELV24_25715; ELV26_25060; ELV28_26305; ELV28_27750; ELV29_24420; ELX68_23645; ELX68_25470; ELX76_26265; ELX76_27795; ELX79_23870; ELX79_27590; ELX83_25375; ELX83_26555; ELX96_23205; ELX96_27870; ELY23_24500; ELY23_26210; ELY32_25885; ELY32_27300; ELY41_22960; ELY41_28095; ELY48_25510; ELY48_27265; ELY50_25030; ELY50_27010; EXX13_27085; F0L67_27205; FKO60_26910; FZC17_05390; G3565_28015; GLW94_27755; GLW94_28285; GRC73_23675; GRC73_24560; HL601_26105; HL601_27185; HLV18_23895; HLV18_24740; HMV95_21525; HMV95_26380; RCS76_PICDS8925D; RCS78_P0020
• Molecule Type: Protein
• Gene Name: dfrA17
• Gene ID: 58463194
• Sequence:
  MKISLISAVSENGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
  VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
  EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
• Function: Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
• Uniprot ID: Q7BPP7_ECOLX

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 5 drug(s) in total

Amikacin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Urinary tract infection [1]

• Sensitive Disease: Urinary tract infection [ICD-11: GC08.1]
• Sensitive Drug: Amikacin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli serogroup O11; 1095705
• In Vitro Model: Escherichia coli serogroup O17; 1010800
• In Vitro Model: Escherichia coli serogroup O73; 2170725
• In Vitro Model: Escherichia coli serogroup O77; 562
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Microdilution method assay
• Mechanism Description: All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Ampicillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Urinary tract infection [1]

• Resistant Disease: Urinary tract infection [ICD-11: GC08.1]
• Resistant Drug: Ampicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli serogroup O11; 1095705
• In Vitro Model: Escherichia coli serogroup O17; 1010800
• In Vitro Model: Escherichia coli serogroup O73; 2170725
• In Vitro Model: Escherichia coli serogroup O77; 562
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Microdilution method assay
• Mechanism Description: All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Ciprofloxacin XR

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Urinary tract infection [1]

• Resistant Disease: Urinary tract infection [ICD-11: GC08.1]
• Resistant Drug: Ciprofloxacin XR
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli serogroup O11; 1095705
• In Vitro Model: Escherichia coli serogroup O17; 1010800
• In Vitro Model: Escherichia coli serogroup O73; 2170725
• In Vitro Model: Escherichia coli serogroup O77; 562
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Microdilution method assay
• Mechanism Description: All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Co-trimoxazole

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Urinary tract infection [1]

• Resistant Disease: Urinary tract infection [ICD-11: GC08.1]
• Resistant Drug: Co-trimoxazole
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli serogroup O11; 1095705
• In Vitro Model: Escherichia coli serogroup O17; 1010800
• In Vitro Model: Escherichia coli serogroup O73; 2170725
• In Vitro Model: Escherichia coli serogroup O77; 562
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Microdilution method assay
• Mechanism Description: All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Gentamicin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Urinary tract infection [1]

• Resistant Disease: Urinary tract infection [ICD-11: GC08.1]
• Resistant Drug: Gentamicin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli serogroup O11; 1095705
• In Vitro Model: Escherichia coli serogroup O17; 1010800
• In Vitro Model: Escherichia coli serogroup O73; 2170725
• In Vitro Model: Escherichia coli serogroup O77; 562
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Microdilution method assay
• Mechanism Description: All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

References

• Ref 1: Global spread of mobile antimicrobial drug resistance determinants in human and animal Escherichia coli and Salmonella strains causing community-acquired infections. Clin Infect Dis. 2009 Aug 1;49(3):365-71. doi: 10.1086/600301.