Molecule Information

General Information of the Molecule (ID: Mol00853)

Name	Carboxymethylenebutenolidase (CLCD) ,Clostridium homopropionicum
Synonyms	CLHOM_33680 Click to Show/Hide
Molecule Type	Protein
Gene Name	clcD
Sequence	MKIINNSDSVIIVLHEIYGINQHIRMACEKFSTNGYDIICPNLIHVNQPFSYDLQEEAYR HFINNIGFYSATKQVKQLILEAKEKYNHVYLLGYSIGATIAWLCSNGENMCDGIIGYYGS RIRDYMNITPKCPALLIFPTEEKSFNVQELVDSLGKCNIDAFILNGKHGFSDPFSENYCA QSFEKAERLVSNFLKK Click to Show/Hide
Uniprot ID	A0A0L6Z678_9CLOT
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Clostridia Order: Eubacteriales Family: Clostridiaceae Genus: Clostridium Species: Clostridium homopropionicum

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

4 drug(s) in total

Click to Show/Hide the Full List of Drugs

Clindamycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Clindamycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli AS19		562
Experiment for Drug Resistance	MIC assay
Mechanism Description	The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme.

Florfenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Florfenicol		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli AS19		562
Experiment for Drug Resistance	MIC assay
Mechanism Description	The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme.

Linezolid

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Linezolid		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli AS19		562
Experiment for Drug Resistance	MIC assay
Mechanism Description	The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme.

Tiamulin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Tiamulin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli AS19		562
Experiment for Drug Resistance	MIC assay
Mechanism Description	The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme.

References

Ref 1	A cfr-like gene from Clostridium difficile confers multiple antibiotic resistance by the same mechanism as the cfr gene. Antimicrob Agents Chemother. 2015 Sep;59(9):5841-3. doi: 10.1128/AAC.01274-15. Epub 2015 Jul 6.