General Information of the Molecule (ID: Mol00844)
Name
Beta-lactamase (BLA) ,Salmonella enterica serotype wien
Synonyms
bla_SHV-12
    Click to Show/Hide
Molecule Type
Protein
Gene Name
blaSHV-12
Sequence
MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
    Click to Show/Hide
Uniprot ID
B1NX62_SALET
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica subsp. enterica serovar Braenderup
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ceftazidime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Ceftazidime
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Enterobacter cloacae strains ENLA-1 550
Escherichia coli strain ECAA-1 562
Escherichia coli strain ECLA-1 562
Escherichia coli strain ECLA-2 562
Escherichia coli strain ECLA-4 562
Escherichia coli strain ECZK-1 562
Escherichia coli strain ECZP-1 562
Escherichia coli strain ECZU-1 562
Escherichia coli strain HK225f 562
Salmonella enterica serotype wien strain SWLA-1 149384
Salmonella enterica serotype wien strain SWLA-2 149384
Klebsiella pneumoniae strains kPAA-1 573
Klebsiella pneumoniae strains kPBE-2 573
Klebsiella pneumoniae strains kPGE-1 573
Klebsiella pneumoniae strains kPGE-2 573
Klebsiella pneumoniae strains kPLA-1 573
Klebsiella pneumoniae strains kPLA-10 573
Klebsiella pneumoniae strains kPLA-2 573
Klebsiella pneumoniae strains kPLA-3 573
Klebsiella pneumoniae strains kPLA-4 573
Klebsiella pneumoniae strains kPLA-5 573
Klebsiella pneumoniae strains kPLA-6 573
Klebsiella pneumoniae strains kPLA-7 573
Klebsiella pneumoniae strains kPLA-8 573
Klebsiella pneumoniae strains kPLA-9 573
Klebsiella pneumoniae strains kPZU-1 573
Klebsiella pneumoniae strains kPZU-10 573
Klebsiella pneumoniae strains kPZU-11 573
Klebsiella pneumoniae strains kPZU-12 573
Klebsiella pneumoniae strains kPZU-13 573
Klebsiella pneumoniae strains kPZU-4 573
Klebsiella pneumoniae strains kPZU-6 573
Klebsiella pneumoniae strains kPZU-7 573
Klebsiella pneumoniae strains kPZU-8 573
Klebsiella pneumoniae strains kPZU-9 573
Experiment for
Molecule Alteration
Hybridization experiments assay
Experiment for
Drug Resistance
Microdilution method assay
Mechanism Description Of 60 strains with reduced susceptibility to expanded-spectrum cephalosporins which had been collected, 34 (24Klebsiella pneumoniae, 7Escherichia coli, 1Enterobacter cloacae, and 2Salmonella entericaserotypewien) hybridized with the intragenic blaSHVprobe. TheblaSHVgenes were amplified by PCR, and the presence ofblaSHV-ESBLwas established in 29 strains by restriction enzyme digests of the resulting 1,018-bp amplimers as described elsewhere. These results were confirmed by the nucleotide sequencing of all 34 amplimers. Five strains contained SHV non-ESBL enzymes.
Ceftriaxone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Salmonella enterica infection [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Ceftriaxone
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Enterobacter cloacae strains ENLA-1 550
Escherichia coli strain ECAA-1 562
Escherichia coli strain ECLA-1 562
Escherichia coli strain ECLA-2 562
Escherichia coli strain ECLA-4 562
Escherichia coli strain ECZK-1 562
Escherichia coli strain ECZP-1 562
Escherichia coli strain ECZU-1 562
Escherichia coli strain HK225f 562
Salmonella enterica serotype wien strain SWLA-1 149384
Salmonella enterica serotype wien strain SWLA-2 149384
Klebsiella pneumoniae strains kPAA-1 573
Klebsiella pneumoniae strains kPBE-2 573
Klebsiella pneumoniae strains kPGE-1 573
Klebsiella pneumoniae strains kPGE-2 573
Klebsiella pneumoniae strains kPLA-1 573
Klebsiella pneumoniae strains kPLA-10 573
Klebsiella pneumoniae strains kPLA-2 573
Klebsiella pneumoniae strains kPLA-3 573
Klebsiella pneumoniae strains kPLA-4 573
Klebsiella pneumoniae strains kPLA-5 573
Klebsiella pneumoniae strains kPLA-6 573
Klebsiella pneumoniae strains kPLA-7 573
Klebsiella pneumoniae strains kPLA-8 573
Klebsiella pneumoniae strains kPLA-9 573
Klebsiella pneumoniae strains kPZU-1 573
Klebsiella pneumoniae strains kPZU-10 573
Klebsiella pneumoniae strains kPZU-11 573
Klebsiella pneumoniae strains kPZU-12 573
Klebsiella pneumoniae strains kPZU-13 573
Klebsiella pneumoniae strains kPZU-4 573
Klebsiella pneumoniae strains kPZU-6 573
Klebsiella pneumoniae strains kPZU-7 573
Klebsiella pneumoniae strains kPZU-8 573
Klebsiella pneumoniae strains kPZU-9 573
Experiment for
Molecule Alteration
Hybridization experiments assay
Experiment for
Drug Resistance
Microdilution method assay
Mechanism Description Of 60 strains with reduced susceptibility to expanded-spectrum cephalosporins which had been collected, 34 (24Klebsiella pneumoniae, 7Escherichia coli, 1Enterobacter cloacae, and 2Salmonella entericaserotypewien) hybridized with the intragenic blaSHVprobe. TheblaSHVgenes were amplified by PCR, and the presence ofblaSHV-ESBLwas established in 29 strains by restriction enzyme digests of the resulting 1,018-bp amplimers as described elsewhere. These results were confirmed by the nucleotide sequencing of all 34 amplimers. Five strains contained SHV non-ESBL enzymes.
References
Ref 1 Survey and molecular genetics of SHV beta-lactamases in Enterobacteriaceae in Switzerland: two novel enzymes, SHV-11 and SHV-12. Antimicrob Agents Chemother. 1997 May;41(5):943-9. doi: 10.1128/AAC.41.5.943.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.