Molecule Information
General Information of the Molecule (ID: Mol00831)
Name |
Beta-lactamase (BLA)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
bla; bla_1; blaCTX-M; blaCTX-M-15; blaCTX-M-3; CTX-M-57; BJJ90_28645; BK383_23175; BVL39_25925; C5Y87_27520; CDL36_28010; D9C02_24490; DM870_24300; DS732_31125; EAI46_08065; EIA08_20890; EIZ93_26440; ELT20_21470; ELT21_22800; ELT36_16845; ELT58_24780; ELV05_08105; ELV08_25910; ELV40_24885; ELY02_21550; ELY05_21460; ELY05_24820; FKO60_26825; HHH44_004851; HHH44_005271; HLZ50_25860; HLZ50_26760; HNC59_29660; HNC99_27310; HNC99_29655; JFD_05359; M55_021; pHNFP460_058; TUM18780_46190
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
blaCTX-M-55
|
||||
Sequence |
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ
ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGS GGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Ceftazidime
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Klebsiella pneumoniae | [1] | |||
Resistant Disease | Klebsiella pneumoniae [ICD-11: CA40.0] | |||
Resistant Drug | Ceftazidime | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae isolates | 573 | ||
Experiment for Molecule Alteration |
PCR and molecular characterization assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | CTX-M-55 is a novel ceftazidime-resistant CTX-M extended-spectrum Beta-lactamase, which reduced susceptibility. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Ceftazidime | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli JM109 | 562 | ||
Experiment for Molecule Alteration |
PCR and molecular characterization assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | CTX-M-55 is a novel ceftazidime-resistant CTX-M extended-spectrum Beta-lactamase, which reduced susceptibility. |
Ceftriaxone
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Klebsiella pneumoniae | [1] | |||
Resistant Disease | Klebsiella pneumoniae [ICD-11: CA40.0] | |||
Resistant Drug | Ceftriaxone | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae isolates | 573 | ||
Experiment for Molecule Alteration |
PCR and molecular characterization assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | CTX-M-55 is a novel ceftazidime-resistant CTX-M extended-spectrum Beta-lactamase, which reduced susceptibility. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Ceftriaxone | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli JM109 | 562 | ||
Experiment for Molecule Alteration |
PCR and molecular characterization assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | CTX-M-55 is a novel ceftazidime-resistant CTX-M extended-spectrum Beta-lactamase, which reduced susceptibility. |
Ciprofloxacin XR
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Klebsiella pneumoniae | [1] | |||
Resistant Disease | Klebsiella pneumoniae [ICD-11: CA40.0] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae isolates | 573 | ||
Experiment for Molecule Alteration |
PCR and molecular characterization assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | CTX-M-55 is a novel ceftazidime-resistant CTX-M extended-spectrum Beta-lactamase, which reduced susceptibility. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli JM109 | 562 | ||
Experiment for Molecule Alteration |
PCR and molecular characterization assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | CTX-M-55 is a novel ceftazidime-resistant CTX-M extended-spectrum Beta-lactamase, which reduced susceptibility. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.