Molecule Information

General Information of the Molecule (ID: Mol00829)

• Name: Beta-lactamase (BLA) ,Rhodobacter sphaeroides
• Synonyms: RSP_3749
• Molecule Type: Protein
• Gene Name: ampC
• Sequence:
  MKHLSPLSILLMVGALTPALAQDTTPSFESAAAAAFESVIEEHDIPGLVVGVTHGGRHSF
  YQTGLASREDQQPVTPDTLFELGSISKIFNVTLAALAEERGALSLDAPVADYLPSLRGSP
  AGELTLIDLATHHTGGLPLQVPDEVADVDRLVDWLRSWRPPEPGTRSYSNISIGLLGHIT
  AGVLGMSYADASQTVIFPALGLKSTWIDVPTDAMGRYAFGYDRKTDAPTRVTPGVLDDEA
  YGVKSSARDMLTLLDLELGTGTASPEVQTAVATTQEGRFQTRLYTQAMIWEAYPWPVDPE
  RLVEGNGYDFILQPQPVDEVDTTPDRRVILNKTGSTNGFGGYIAIVPSEDLGVVVLANRN
  YPNEARVRATYDLITHILAE
• Uniprot ID: Q3IVS9_CERS4

Kingdom: N.A.
Phylum: Proteobacteria
Class: Alphaproteobacteria
Order: Rhodobacterales
Family: Rhodobacteraceae
Genus: Cereibacter
Species: Cereibacter sphaeroides

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 7 drug(s) in total

Benzylpenicillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Benzylpenicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

Cefalotin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cefalotin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

Cefradine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cefradine
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

Cephalexin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cephalexin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

Cephalosporin C

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cephalosporin C
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

Cephapirin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cephapirin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

Meticillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Rhodobacter sphaeroides infection [1]

• Resistant Disease: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Meticillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM 160(Y); 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM158; 1063
• In Vitro Model: Rhodopseudomonas sphaeroides strain DSM159; 1063
• Experiment for Molecule Alteration: Sodium dodecyl sulfate-PAGE assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.

References

• Ref 1: Susceptibility of Rhodobacter sphaeroides to beta-lactam antibiotics: isolation and characterization of a periplasmic beta-lactamase (cephalosporinase). J Bacteriol. 1989 Jan;171(1):308-13. doi: 10.1128/jb.171.1.308-313.1989.