Molecule Information

General Information of the Molecule (ID: Mol00803)

Name	ARE-ABC-F family resistance factor PoxtA (POXTA) ,Staphylococcus aureus
Synonyms	poxtA; ARE-ABC-F family resistance factor PoxtA Click to Show/Hide
Molecule Type	Protein
Gene Name	poxtA
Sequence	MKGKNMNLAFGLEEIYEDAEFQIGDLDKVGIVGVNGAGKTTLFRLLLGELELDNGSLTSG NARIGYLPQEIVLEDEDITVWDFLFEGRPIKKYEQELEEIYKKLETAVNAEQEALLARMG TLQERLEYFDFYEAETILLEFADKMSIDAELYHRPMRELSGGQKSKMAFARLLYSKPEIL LLDEPTNHLDVSTKDFVIKYLKNYRGSVLIISHDIDFLNRIINKIMYINKATHKISVYDG DYYIYKKKYAEEQRIREMAIVQQEKEIKELSDFVQKAKQASQTNHHLKRMGQERALRLDK KRGELQKRNRLYKRVKMDIRPKREGAQVPLEVENITFHYSGYPTLYQNLSFQINGRERFL VVGENGVGKSTLLKLMMGILSPDEGCIRFNQKTDIAYYAQELEQLDENKTVIDNVESEGY TPWQIRAVLSNFLFYDDDVNKKVSVLSPGEKARVALCKILLQKANLLILDEPTNHLDPET QKIIGGNFNLFEGTIIAVSHNPSFVEQIGISRMLILPSGRIEPYSRELLEYYYEINGSVA KF Click to Show/Hide
Uniprot ID	A0A2R3EPU8_STAAU
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Bacillales Family: Staphylococcaceae Genus: Staphylococcus Species: Staphylococcus aureus

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

5 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus aureus RN4220		1280
	Enterococcus faecalis JH2-2		1351
	Escherichia coli Mach1 T1R		562
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth dilution test assay
Mechanism Description	The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection.

Doxycycline

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Doxycycline		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus aureus RN4220		1280
	Enterococcus faecalis JH2-2		1351
	Escherichia coli Mach1 T1R		562
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth dilution test assay
Mechanism Description	The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection.

Florfenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Florfenicol		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus aureus RN4220		1280
	Enterococcus faecalis JH2-2		1351
	Escherichia coli Mach1 T1R		562
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth dilution test assay
Mechanism Description	The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection.

Linezolid

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Linezolid		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus aureus RN4220		1280
	Enterococcus faecalis JH2-2		1351
	Escherichia coli Mach1 T1R		562
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth dilution test assay
Mechanism Description	The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection.

Tetracycline

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Tetracycline		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus aureus RN4220		1280
	Enterococcus faecalis JH2-2		1351
	Escherichia coli Mach1 T1R		562
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth dilution test assay
Mechanism Description	The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection.

References

Ref 1	Characterization of poxtA, a novel phenicol-oxazolidinone-tetracycline resistance gene from an MRSA of clinical origin. J Antimicrob Chemother. 2018 Jul 1;73(7):1763-1769. doi: 10.1093/jac/dky088.