Molecule Information

General Information of the Molecule (ID: Mol00789)

• Name: Aminoglycoside 3'-phosphotransferase (A3AP) ,Stenotrophomonas maltophilia
• Molecule Type: Protein
• Gene Name: aph(3')-IIc
• Sequence:
  MEASNPFTDGLRLPRAWQEALADAHIERQSIGVSRADVARVHRPGQTDAFLKSEVIDAFS
  ELGDEIARLRWLQAQGQSAPTVIATTEEGGRRWLLMSALPGRDLASSPELAPRRVAELLA
  DALRGLHAVPVANCPFDQQLASRLQAAQARVEAGLVDADDFDDERLGQSPQQVFAELRAT
  RPAHEDLVVSQGDACLPNLTVTDGRFTGFIDCGRLGVADRYQDLALAARSLVHNFGESRC
  VAALFQRYGAVPDERRLAFYRLLDEFF
• Uniprot ID: E5LCR3_STEMA

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Xanthomonadales
Family: Xanthomonadaceae
Genus: Stenotrophomonas
Species: Stenotrophomonas maltophilia

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Framycetin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Stenotrophomonas maltophilia infection [1]

• Resistant Disease: Stenotrophomonas maltophilia infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Framycetin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: PCR amplification assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Aph(3')-IIc significantly increases MICs of kanamycin, neomycin, butirosin, and paromomycin when expressed in Escherichia coli. Disruption of aph(3')-IIc results in decreased MICs of these drugs.

Kanamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Stenotrophomonas maltophilia infection [1]

• Resistant Disease: Stenotrophomonas maltophilia infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Kanamycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: PCR amplification assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Aph(3')-IIc significantly increases MICs of kanamycin, neomycin, butirosin, and paromomycin when expressed in Escherichia coli. Disruption of aph(3')-IIc results in decreased MICs of these drugs.

Paromomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Stenotrophomonas maltophilia infection [1]

• Resistant Disease: Stenotrophomonas maltophilia infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Paromomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: PCR amplification assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Aph(3')-IIc significantly increases MICs of kanamycin, neomycin, butirosin, and paromomycin when expressed in Escherichia coli. Disruption of aph(3')-IIc results in decreased MICs of these drugs.

Investigative Drug(s) 1 drug(s) in total

Butirosina

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Stenotrophomonas maltophilia infection [1]

• Resistant Disease: Stenotrophomonas maltophilia infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Butirosina
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: PCR amplification assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Aph(3')-IIc significantly increases MICs of kanamycin, neomycin, butirosin, and paromomycin when expressed in Escherichia coli. Disruption of aph(3')-IIc results in decreased MICs of these drugs.

References

• Ref 1: Aph(3')-IIc, an aminoglycoside resistance determinant from Stenotrophomonas maltophilia. Antimicrob Agents Chemother. 2007 Jan;51(1):359-60. doi: 10.1128/AAC.00795-06. Epub 2006 Nov 6.