Molecule Information
General Information of the Molecule (ID: Mol00752)
Name |
23S ribosomal RNA methyltransferase Erm36 (ERM36)
,Micrococcus luteus
|
||||
---|---|---|---|---|---|
Synonyms |
ermML; erm36; 23S ribosomal RNA methyltransferase ErmML
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
ermML
|
||||
Sequence |
MPTYRGGRHEHGQNFLTDHTTIDRLSRLVGDSTGPIVEIGPGQGRLTRELQKLGRSLTAV
EIDSRLADRLASASQFREQKHVTVVNADFLHWPLPTTPYVVVGNVPFHLTTAILRRLLHD GAWTQVVLLVQWEVARRRAGIGGSSMMTAQWWPWIDFSLHGRVPRSAFKPAPSVDGGLLE MTRRPDPLLSPDARESYRQFVHDVFTSRGRGIGEILANVSSSLGKRGALQLLKSEGIRSS SLPKDLSAEQWARLFTSASPTKSAKTGRNAHPAHSARRQGR Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Clindamycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Micrococcus luteus infection | [1] | |||
Resistant Disease | Micrococcus luteus infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Clindamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Micrococcus luteus MAW843 | 1270 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
Agar diffusion test assay | |||
Mechanism Description | Erm(36) was most related (about 52-54% identity) to erythromycin-resistance proteins found in high-G+C Gram-positive bacteria and lead to drug resistance. |
Erythromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Micrococcus luteus infection | [1] | |||
Resistant Disease | Micrococcus luteus infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Micrococcus luteus MAW843 | 1270 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
Agar diffusion test assay | |||
Mechanism Description | Erm(36) was most related (about 52-54% identity) to erythromycin-resistance proteins found in high-G+C Gram-positive bacteria and lead to drug resistance. |
Lincomycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Micrococcus luteus infection | [1] | |||
Resistant Disease | Micrococcus luteus infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Lincomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Micrococcus luteus MAW843 | 1270 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
Agar diffusion test assay | |||
Mechanism Description | Erm(36) was most related (about 52-54% identity) to erythromycin-resistance proteins found in high-G+C Gram-positive bacteria and lead to drug resistance. |
Matromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Micrococcus luteus infection | [1] | |||
Resistant Disease | Micrococcus luteus infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Matromycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Micrococcus luteus MAW843 | 1270 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
Agar diffusion test assay | |||
Mechanism Description | Erm(36) was most related (about 52-54% identity) to erythromycin-resistance proteins found in high-G+C Gram-positive bacteria and lead to drug resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.